LXL04_019203 | RubberDandelionOmics

Gene overview

LXL04_019203

Reference: OH-1004 Chr: Chr04 Coordinates: 26499568-26500767 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

813 bp · LXL04_019203|LXL04_019203|OH1004|cDNA

ATGAGTTTTCCCCATGATGGTGGTTCTAGTTTTTCAGCTTTTGTACGCAAAGCAGATTCTGTACAAAACGTAGATCCATGTGCGAATGGGATCCGTGTAAGGGATGGATCTAATGATCCTTATAGTGGTGCTAGTTTTTCCGATTTTGTGCACCAGGCCAATTCTGTACTCGCCGTCCCTCCAGGTGTGAATGGGAACCTTGTATGGGATACTGGTGCTAGTTATTCAGCTTTTGTCCACCAAGCCGACTCTATAAGCAT...

CDS

Download CDS FASTA

813 bp · LXL04_019203|LXL04_019203|OH1004|CDS

ATGAGTTTTCCCCATGATGGTGGTTCTAGTTTTTCAGCTTTTGTACGCAAAGCAGATTCTGTACAAAACGTAGATCCATGTGCGAATGGGATCCGTGTAAGGGATGGATCTAATGATCCTTATAGTGGTGCTAGTTTTTCCGATTTTGTGCACCAGGCCAATTCTGTACTCGCCGTCCCTCCAGGTGTGAATGGGAACCTTGTATGGGATACTGGTGCTAGTTATTCAGCTTTTGTCCACCAAGCCGACTCTATAAGCAT...

Protein

Download Protein FASTA

270 aa · LXL04_019203|LXL04_019203|OH1004|PROTEIN

MSFPHDGGSSFSAFVRKADSVQNVDPCANGIRVRDGSNDPYSGASFSDFVHQANSVLAVPPGVNGNLVWDTGASYSAFVHQADSISIVDPQSNMVFSQEEESLKGSSPDIGEVTVKQVLLQHAMIVPETTSIYEACCQMAAGKADALVITDSNAKLSGVTNSIKCSFWCLKDFVKRIIARGIDVVNTPVSKVMTKNPIFVMSDALCVKALQKMVQGKVKQLPVLENGRVIGLANLTICLFGFGNYPEGIDENHLVILAAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019203`
TK1151 ID	TkA05G029980
OH-1004 ID	LXL04_019203
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.800
Protein coverage (%)	TK1151 98.492 / OH-1004 75.556 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019203

Location Chr04:26499568-26500767 (+)

Description Similar to CBSCBSPB1: CBS domain-containing protein CBSCBSPB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63490`	CBS domain-containing protein CBSCBSPB1.	No verified direct reference in this release
`At5g50640`	CBS domain-containing protein CBSCBSPB5.	No verified direct reference in this release
`At5g50530`	CBS domain-containing protein CBSCBSPB4.	No verified direct reference in this release
`At3g52950`	CBS domain-containing protein CBSCBSPB3.	No verified direct reference in this release
`At2g36500`	CBS domain-containing protein CBSCBSPB2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019203 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G36500

ath:AT3G52950

ath:AT5G50530

ath:AT5G50640

ath:AT5G63490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · LXL04_019203 · OH-1004

Nucleus0.379

Rank 2 · LXL04_019203 · OH-1004

Cell membrane0.128

Rank 3 · LXL04_019203 · OH-1004

Endoplasmic reticulum0.083

Rank 4 · LXL04_019203 · OH-1004

Lysosome / Vacuole0.066

Rank 5 · LXL04_019203 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00571.34CBS189-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019203	`PF00571.34`	CBS	189	232	6.9e-12	46.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMV3`	Arabidopsis thaliana	CBS domain-containing protein CBSCBSPB1	47.742%	Swiss-Prot	moderate database homology
`P0DH79`	Arabidopsis thaliana	CBS domain-containing protein CBSCBSPB5	45.806%	Swiss-Prot	moderate database homology
`Q0WLC7`	Arabidopsis thaliana	CBS domain-containing protein CBSCBSPB4	45.806%	Swiss-Prot	moderate database homology
`Q9LF97`	Arabidopsis thaliana	CBS domain-containing protein CBSCBSPB3	45.513%	Swiss-Prot	moderate database homology
`Q9SJQ5`	Arabidopsis thaliana	CBS domain-containing protein CBSCBSPB2	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card