LXL04_019197 | RubberDandelionOmics

Gene overview

LXL04_019197

Reference: OH-1004 Chr: Chr04 Coordinates: 26332968-26335872 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1674 bp · LXL04_019197|LXL04_019197|OH1004|cDNA

ATGAGCTGCCTCTTTCACCACCACCGTCTTCTTTCTCTTTCACGAAATTTTCAACATGATAACCGCTGTTTCAGAGTTCAATCATACATACGAATCCCTGATTGTTCAATTCGACTTCGAACTCCACCAAAATCATCATCCAGACAAAACCCTAGCACCTCATCCCAAGAACGCCCCATTGGAAAACCTGAATCCGAGTCCCAATTTGATTCGGATAACAACGATAAGAACTTGGATACATCGTCATCTTCCACTTCGAC...

CDS

Download CDS FASTA

1674 bp · LXL04_019197|LXL04_019197|OH1004|CDS

ATGAGCTGCCTCTTTCACCACCACCGTCTTCTTTCTCTTTCACGAAATTTTCAACATGATAACCGCTGTTTCAGAGTTCAATCATACATACGAATCCCTGATTGTTCAATTCGACTTCGAACTCCACCAAAATCATCATCCAGACAAAACCCTAGCACCTCATCCCAAGAACGCCCCATTGGAAAACCTGAATCCGAGTCCCAATTTGATTCGGATAACAACGATAAGAACTTGGATACATCGTCATCTTCCACTTCGAC...

Protein

Download Protein FASTA

557 aa · LXL04_019197|LXL04_019197|OH1004|PROTEIN

MSCLFHHHRLLSLSRNFQHDNRCFRVQSYIRIPDCSIRLRTPPKSSSRQNPSTSSQERPIGKPESESQFDSDNNDKNLDTSSSSTSTSSNPFKLLIHSFSENLKFDELAMEIMSIALPAALALAADPITSLVDTAFVGHLGSAELAAVGVSISIFNLVAKLFNIPLLNITTSFVAEEQAVSSSKDDDDSSKVSKKKRFLPSVSTSLALAGAFGIAETIALSLGSGLLLNTMGIPVDSPMRVPAEQFTSIRAFGAPAIVLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019197`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019197

Location Chr04:26332968-26335872 (+)

Description Similar to DTX44: Protein DETOXIFICATION 44, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38330`	Protein DETOXIFICATION 44, chloroplastic.	No verified direct reference in this release
`At4g38380`	Protein DETOXIFICATION 45, chloroplastic.	No verified direct reference in this release
`At1g51340`	Citrate transporter critical for aluminum tolerance.	Aluminum-activated citrate and malate transporters from the MATE and ALMT families function independently to confer Arabidopsis aluminum tolerance.2009 · DOI: 10.1111/j.1365-313x.2008.03696.x A promoter-swap strategy between the AtALMT and AtMATE genes increased Arabidopsis aluminum resistance and improved carbon-use efficiency for aluminum resistance.2012 · DOI: 10.1111/j.1365-313x.2012.04994.x
`At3g08040`	Citrate transporter responsible for loading citrate into xylem tissues, which helps facilitate iron transport to shoots.	FRD3, a member of the multidrug and toxin efflux family, controls iron deficiency responses in Arabidopsis.2002 · DOI: 10.1105/tpc.001495 FRD3 controls iron localization in Arabidopsis.2004 · DOI: 10.1104/pp.104.045633 The FRD3-mediated efflux of citrate into the root vasculature is necessary for efficient iron translocation.2007 · DOI: 10.1104/pp.107.097162 The FRD3 citrate effluxer promotes iron nutrition between symplastically disconnected tissues throughout Arabidopsis development.2011 · DOI: 10.1105/tpc.111.088088
`At2g21340`	Protein DETOXIFICATION 46, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019197 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0015746 citrate transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030001 metal ion transport Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

KEGG gene cross-reference

ath:AT1G51340

ath:AT2G21340

ath:AT2G38330

ath:AT3G08040

ath:AT4G38380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · LXL04_019197 · OH-1004

Peroxisome0.023

Rank 2 · LXL04_019197 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_019197 · OH-1004

Golgi apparatus0.018

Rank 4 · LXL04_019197 · OH-1004

Endoplasmic reticulum0.017

Rank 5 · LXL04_019197 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE118-159 aa

PF01554.24MatE195-291 aa

PF01554.24MatE355-498 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019197	`PF01554.24`	MatE	118	159	2.1e-27	96.5
LXL04_019197	`PF01554.24`	MatE	195	291	2.1e-27	96.5
LXL04_019197	`PF01554.24`	MatE	355	498	2.1e-27	96.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84K71`	Arabidopsis thaliana	Protein DETOXIFICATION 44, chloroplastic	59.665%	Swiss-Prot	strong database homology
`Q9SVE7`	Arabidopsis thaliana	Protein DETOXIFICATION 45, chloroplastic	49.451%	Swiss-Prot	moderate database homology
`Q9SYD6`	Arabidopsis thaliana	Protein DETOXIFICATION 42	45.276%	Swiss-Prot	moderate database homology
`Q9SFB0`	Arabidopsis thaliana	Protein DETOXIFICATION 43	42.914%	Swiss-Prot	moderate database homology
`Q8W4G3`	Arabidopsis thaliana	Protein DETOXIFICATION 46, chloroplastic	26.078%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card