LXL04_019194 | RubberDandelionOmics

Gene overview

LXL04_019194

Reference: OH-1004 Chr: Chr04 Coordinates: 26297186-26297749 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · LXL04_019194|LXL04_019194|OH1004|cDNA

ATGCCAAAAATGGGTGGCGATCATAAGAACACGACGGAGAAAGGGGTGGCAAAGGGCTGCATCAGGTCGGAAAAAGGGCCATGGGTGGTTCACCGGACCACCAAAGACGGCCGTGTCATCACCAGATACCGGTATCCCTCCGACCAGGAGAGAGTGAAGAACCGTGAAAGAGAAAGAAACCGGCGAAATGTGGCTCGGGAAATCTTTTCCGGGTTACGTGCTTTTGGAAACTATCAACTCTCCAAGAATGCTGATACAAT...

CDS

Download CDS FASTA

465 bp · LXL04_019194|LXL04_019194|OH1004|CDS

ATGCCAAAAATGGGTGGCGATCATAAGAACACGACGGAGAAAGGGGTGGCAAAGGGCTGCATCAGGTCGGAAAAAGGGCCATGGGTGGTTCACCGGACCACCAAAGACGGCCGTGTCATCACCAGATACCGGTATCCCTCCGACCAGGAGAGAGTGAAGAACCGTGAAAGAGAAAGAAACCGGCGAAATGTGGCTCGGGAAATCTTTTCCGGGTTACGTGCTTTTGGAAACTATCAACTCTCCAAGAATGCTGATACAAT...

Protein

Download Protein FASTA

154 aa · LXL04_019194|LXL04_019194|OH1004|PROTEIN

MPKMGGDHKNTTEKGVAKGCIRSEKGPWVVHRTTKDGRVITRYRYPSDQERVKNRERERNRRNVAREIFSGLRAFGNYQLSKNADTIDLLKAVCEEAGWHVEEDGKVYKKHVLLHEHGGYCNCDENIMELSGSKKMAHTDNDVTLSLTLATSFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019194`
TK1151 ID	TkA05G028880
OH-1004 ID	LXL04_019194
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 98.052 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019194

Location Chr04:26297186-26297749 (-)

Description Similar to BZR3: Protein BZR1 homolog 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19350`	Positive regulator of brassinosteroid (BR) signaling.	A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.2005 · DOI: 10.1016/j.cell.2004.11.044 Modulation of brassinosteroid-regulated gene expression by Jumonji domain-containing proteins ELF6 and REF6 in Arabidopsis.2008 · DOI: 10.1073/pnas.0802254105 Arabidopsis MYB30 is a direct target of BES1 and cooperates with BES1 to regulate brassinosteroid-induced gene expression.2009 · DOI: 10.1111/j.1365-313x.2008.03778.x Arabidopsis IWS1 interacts with transcription factor BES1 and is involved in plant steroid hormone brassinosteroid regulated gene expression.2010 · DOI: 10.1073/pnas.0909198107 Histone lysine methyltransferase SDG8 is involved in brassinosteroid-regulated gene expression in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/ssu056 Regulation of plant stem cell quiescence by a brassinosteroid signaling module.2014 · DOI: 10.1016/j.devcel.2014.05.020
`At3g50750`	BES1/BZR1 homolog protein 1.	No verified direct reference in this release
`At1g75080`	Transcriptional repressor that binds to the brassinosteroid (BR) response element (BRRE) 5'-CGTG(T/C)G-3' in gene promoter.	BR signal influences Arabidopsis ovule and seed number through regulating related genes expression by BZR1.2013 · DOI: 10.1093/mp/sss070 Histone Demethylases Coordinate the Antagonistic Interaction Between Abscisic Acid and Brassinosteroid Signaling in Arabidopsis .2020 · DOI: 10.3389/fpls.2020.596835

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0552300`	May function in brassinosteroid signaling.	No verified direct reference in this release
`Os02g0233200`	May function in brassinosteroid signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019194 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009650 UV protection Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048316 seed development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0071367 cellular response to brassinosteroid stimulus Biological Process

GO:1904961 quiescent center organization Biological Process

KEGG gene cross-reference

ath:AT1G19350

ath:AT1G75080

ath:AT3G50750

dosa:Os02g0233200

dosa:Os06g0552300

osa:9267338

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · LXL04_019194 · OH-1004

Cytoplasm0.144

Rank 2 · LXL04_019194 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_019194 · OH-1004

Mitochondrion0.015

Rank 4 · LXL04_019194 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_019194 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05687.19BES1_N44-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019194	`PF05687.19`	BES1_N	44	111	6.1e-25	89.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN63`	Arabidopsis thaliana	Protein BRASSINAZOLE-RESISTANT 2	59.574%	Swiss-Prot	weak database homology
`Q9S7F3`	Arabidopsis thaliana	BES1/BZR1 homolog protein 1	55.319%	Swiss-Prot	weak database homology
`Q8S307`	Arabidopsis thaliana	Protein BRASSINAZOLE-RESISTANT 1	57.447%	Swiss-Prot	weak database homology
`Q5Z9E5`	Oryza sativa subsp. japonica	Protein BZR1 homolog 3	55.319%	Swiss-Prot	weak database homology
`Q6EUF1`	Oryza sativa subsp. japonica	Protein BZR1 homolog 4	55.319%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card