LXL04_019123 | RubberDandelionOmics

Gene overview

LXL04_019123

Reference: OH-1004 Chr: Chr04 Coordinates: 24108472-24111959 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2175 bp · LXL04_019123|LXL04_019123|OH1004|cDNA

ATGGATTTAAATGCATCACCTGAAcctgaagaagatgaagagataTACGAACCGACTTTCAGTGAGGACAGTGCACCAGAAGAAAAAACCAgtcaccatcatcatcatcaataTCAGCATGTAGAACAACACATGGAGACAGCAGTGGATATCATGCGCAGGGAACGTGAAGAAAGAAAGCAAAGGTTGAAAAGAGAACGTCCAGATGACAGACCATCTCACAGACCATCacaaacacaaacacaaacacaaacacaaac...

CDS

Download CDS FASTA

2175 bp · LXL04_019123|LXL04_019123|OH1004|CDS

ATGGATTTAAATGCATCACCTGAACCTGAAGAAGATGAAGAGATATACGAACCGACTTTCAGTGAGGACAGTGCACCAGAAGAAAAAACCAGTCACCATCATCATCATCAATATCAGCATGTAGAACAACACATGGAGACAGCAGTGGATATCATGCGCAGGGAACGTGAAGAAAGAAAGCAAAGGTTGAAAAGAGAACGTCCAGATGACAGACCATCTCACAGACCATCACAAACACAAACACAAACACAAACACAAAC...

Protein

Download Protein FASTA

724 aa · LXL04_019123|LXL04_019123|OH1004|PROTEIN

MDLNASPEPEEDEEIYEPTFSEDSAPEEKTSHHHHHQYQHVEQHMETAVDIMRREREERKQRLKRERPDDRPSHRPSQTQTQTQTQTQAAYKSMEDHPLFNTKNQRTYDKSRLPPGWLDCPAYGQEIGCIVPSKVPLGEAFNDCIVPGKRYSFRQVVHQQRVLGRKLGLVIDLTNTSRYYNVNEMKKEGIKYVKLNCKGRGSVPENEVVNQFVYEASYSYNNLQILKLTILPFNQVSQFLARQKNNAKKYILVHCTHGHN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019123`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019123`
Location	Chr04:24108472-24111959 (+)
Description	Similar to Rngtt: mRNA-capping enzyme
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019123` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006370 7-methylguanosine mRNA capping Biological Process GO:0006396 RNA processing Biological Process GO:0098507 polynucleotide 5' dephosphorylation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0004484 mRNA guanylyltransferase activity Molecular Function GO:0004651 polynucleotide 5'-phosphatase activity Molecular Function GO:0004721 phosphoprotein phosphatase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0005525 GTP binding Molecular Function GO:0008192 RNA guanylyltransferase activity Molecular Function GO:0050355 inorganic triphosphate phosphatase activity Molecular Function
KEGG gene cross-reference	cel:CELE_C03D6.3 dre:405803 hsa:8732 mmu:24018 spo:2540362 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.832

Rank 1 · LXL04_019123 · OH-1004

Cytoplasm0.271

Rank 2 · LXL04_019123 · OH-1004

Mitochondrion0.040

Rank 3 · LXL04_019123 · OH-1004

Cell membrane0.035

Rank 4 · LXL04_019123 · OH-1004

Endoplasmic reticulum0.021

Rank 5 · LXL04_019123 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00782.26DSPc224-306 aa

PF01331.26mRNA_cap_enzyme359-600 aa

PF03919.22mRNA_cap_C639-697 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019123	`PF00782.26`	DSPc	224	306	1.1e-14	55.1
LXL04_019123	`PF01331.26`	mRNA_cap_enzyme	359	600	1.3e-86	290.6
LXL04_019123	`PF03919.22`	mRNA_cap_C	639	697	3.1e-18	67.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card