LXL04_019070 | RubberDandelionOmics

Gene overview

LXL04_019070

Reference: OH-1004 Chr: Chr04 Coordinates: 23079388-23083464 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · LXL04_019070|LXL04_019070|OH1004|cDNA

ATGCCTGGGTTTGAACCCATGACCTCTTATCTAAGAGGCAATGACTCTACCAAATGGGCTAGTCCCACATTAGCAATTGTTCAAATCTTCCTTATTTCAACTCTTTCACTTTCCCCTTTCTCTTTATCTTGCTTCTGTACCCGCGAACCCTCCATCTCAAACACCCAAAATGGCTTGACTGCACTCTCCGATTCGCCGCCGTTGGTCGTCTTCACCACCCGTCGCCTTGAAGAGTTTCTACCATGGAAGACACACAGTCA...

CDS

Download CDS FASTA

1728 bp · LXL04_019070|LXL04_019070|OH1004|CDS

ATGCCTGGGTTTGAACCCATGACCTCTTATCTAAGAGGCAATGACTCTACCAAATGGGCTAGTCCCACATTAGCAATTGTTCAAATCTTCCTTATTTCAACTCTTTCACTTTCCCCTTTCTCTTTATCTTGCTTCTGTACCCGCGAACCCTCCATCTCAAACACCCAAAATGGCTTGACTGCACTCTCCGATTCGCCGCCGTTGGTCGTCTTCACCACCCGTCGCCTTGAAGAGTTTCTACCATGGAAGACACACAGTCA...

Protein

Download Protein FASTA

575 aa · LXL04_019070|LXL04_019070|OH1004|PROTEIN

MPGFEPMTSYLRGNDSTKWASPTLAIVQIFLISTLSLSPFSLSCFCTREPSISNTQNGLTALSDSPPLVVFTTRRLEEFLPWKTHSQLLHCYSQQPPKSNNSKKHLLSWKATEPRFTQLEDQEKEFESKTTQSQKLLETRQSAVTAKEEASLTTLQEKRDLAVAAITTGTFTLQQPPPPPPPPPPTITLTNPQLATLCQDNDVAGLHKFISDNRKNLAVIKEEIPVALQAAVDPGGLVLDSVGGFYNLIDGKKDANLLGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019070`
TK1151 ID	TkA05G016150
OH-1004 ID	LXL04_019070
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.100
Protein coverage (%)	TK1151 90.173 / OH-1004 81.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019070

Location Chr04:23079388-23083464 (-)

Description Similar to FRL3: FRIGIDA-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48385`	FRIGIDA-like protein 3.	No verified direct reference in this release
`At3g22440`	FRIGIDA-like protein 4a.	No verified direct reference in this release
`At4g14900`	FRIGIDA-like protein 4b.	No verified direct reference in this release
`UniProt: A0SWL0`	Involved in flowering time regulation.	No verified direct reference in this release
`At1g31814`	Inactive FRIGIDA-like 2 protein.	FRIGIDA-related genes are required for the winter-annual habit in Arabidopsis.2004 · DOI: 10.1073/pnas.0306778101 FRIGIDA LIKE 2 is a functional allele in Landsberg erecta and compensates for a nonsense allele of FRIGIDA LIKE 1.2006 · DOI: 10.1104/pp.106.085571

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019070 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009908 flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G31814

ath:AT3G22440

ath:AT4G14900

ath:AT5G48385

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.932

Rank 1 · LXL04_019070 · OH-1004

Cytoplasm0.112

Rank 2 · LXL04_019070 · OH-1004

Cell membrane0.039

Rank 3 · LXL04_019070 · OH-1004

Endoplasmic reticulum0.034

Rank 4 · LXL04_019070 · OH-1004

Plastid0.017

Rank 5 · LXL04_019070 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07899.17Frigida191-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019070	`PF07899.17`	Frigida	191	477	6.2e-101	338.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67ZB3`	Arabidopsis thaliana	FRIGIDA-like protein 3	51.229%	Swiss-Prot	strong database homology
`Q9LUV4`	Arabidopsis thaliana	FRIGIDA-like protein 4a	33.862%	Swiss-Prot	moderate database homology
`Q940H8`	Arabidopsis thaliana	FRIGIDA-like protein 4b	31.762%	Swiss-Prot	moderate database homology
`A0SWL0`	Arabidopsis thaliana	FRIGIDA-like protein 2	28.109%	Swiss-Prot	weak database homology
`Q9C6S2`	Arabidopsis thaliana	Inactive FRIGIDA-like protein 2	28.109%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card