LXL04_019057 | RubberDandelionOmics

Gene overview

LXL04_019057

Reference: OH-1004 Chr: Chr04 Coordinates: 22845936-22847391 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

558 bp · LXL04_019057|LXL04_019057|OH1004|cDNA

ATGGAGGAGAAAGGCTGGAGTTTGGACCTGCGTCGGATCCTGGAACCAGAAGGAAACAACGAAAAGAGAGGGTGCAGTAGACGGCGAGAGGGCGACAGAGAGCACAGGGGTTTGGATTCAAGGGAGAAAGGAGCGGTTACTAATGTCAAAGACCAAGGGAGCTGTGGTGCATGCTGGTCATTCTCAGCAACAGGAGCAATGGAAGGAATTAATCAAATCACCACCGGATCTCTCATCAGCCTCTCTGAACAAGAGTTGGT...

CDS

Download CDS FASTA

558 bp · LXL04_019057|LXL04_019057|OH1004|CDS

ATGGAGGAGAAAGGCTGGAGTTTGGACCTGCGTCGGATCCTGGAACCAGAAGGAAACAACGAAAAGAGAGGGTGCAGTAGACGGCGAGAGGGCGACAGAGAGCACAGGGGTTTGGATTCAAGGGAGAAAGGAGCGGTTACTAATGTCAAAGACCAAGGGAGCTGTGGTGCATGCTGGTCATTCTCAGCAACAGGAGCAATGGAAGGAATTAATCAAATCACCACCGGATCTCTCATCAGCCTCTCTGAACAAGAGTTGGT...

Protein

Download Protein FASTA

185 aa · LXL04_019057|LXL04_019057|OH1004|PROTEIN

MEEKGWSLDLRRILEPEGNNEKRGCSRRREGDREHRGLDSREKGAVTNVKDQGSCGACWSFSATGAMEGINQITTGSLISLSEQELVDCDRSFNNGCEGGLMDYAYEFRGRADFDSKTDGTRLLTESKTCFLVVSVIIKTIFMLICFTGSKSNFSVDFNSCCSVAVAVLLPKIVIPFAYLSKCFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019057`
TK1151 ID	TkA05G443680
OH-1004 ID	LXL04_019057
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019057

Location Chr04:22845936-22847391 (+)

Description Similar to RD21C: Probable cysteine protease RD21C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19390`	Probable thiol protease.	No verified direct reference in this release
`At4g36880`	Probable thiol protease.	No verified direct reference in this release
`At3g19400`	Probable thiol protease.	No verified direct reference in this release
`At1g47128`	Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019057 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009845 seed germination Biological Process

GO:0010114 response to red light Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

KEGG gene cross-reference

ath:AT1G47128

ath:AT3G19390

ath:AT3G19400

ath:AT4G36880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.391

Rank 1 · LXL04_019057 · OH-1004

Nucleus0.235

Rank 2 · LXL04_019057 · OH-1004

Extracellular0.201

Rank 3 · LXL04_019057 · OH-1004

Mitochondrion0.150

Rank 4 · LXL04_019057 · OH-1004

Cell membrane0.079

Rank 5 · LXL04_019057 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00112.30Peptidase_C138-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019057	`PF00112.30`	Peptidase_C1	38	111	5.1e-29	102.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT78`	Arabidopsis thaliana	Probable cysteine protease RD21C	59.406%	Swiss-Prot	moderate database homology
`Q94B08`	Arabidopsis thaliana	Germination-specific cysteine protease 1	58.163%	Swiss-Prot	moderate database homology
`Q9LT77`	Arabidopsis thaliana	Probable cysteine protease RDL2	58.252%	Swiss-Prot	moderate database homology
`P43297`	Arabidopsis thaliana	Cysteine proteinase RD21A	68.750%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card