LXL04_019018 | RubberDandelionOmics

Gene overview

LXL04_019018

Reference: OH-1004 Chr: Chr04 Coordinates: 22112638-22115709 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · LXL04_019018|LXL04_019018|OH1004|cDNA

ATGGACAGGATAGTCGGAGGAAAGTACAAACTCGGCCGTAAGATCGGAAGTGGATCCTTCGGTGAAATTCATCTAGCAACGCATGTTGATACGTTTGAAATCGTCGCCATCAAGATCGAGAACAATAAGACAAAGCATCCGCAACTTCTATATGAAGCCAAGTTATACAACATTCTTCAGGGAGGAAGTGGTATACCTGCCATAAAATGGTCCGGTGTAGATGGAGAGGACAACATTTTAGTACTCGATTTGCTGGGACC...

CDS

Download CDS FASTA

1332 bp · LXL04_019018|LXL04_019018|OH1004|CDS

ATGGACAGGATAGTCGGAGGAAAGTACAAACTCGGCCGTAAGATCGGAAGTGGATCCTTCGGTGAAATTCATCTAGCAACGCATGTTGATACGTTTGAAATCGTCGCCATCAAGATCGAGAACAATAAGACAAAGCATCCGCAACTTCTATATGAAGCCAAGTTATACAACATTCTTCAGGGAGGAAGTGGTATACCTGCCATAAAATGGTCCGGTGTAGATGGAGAGGACAACATTTTAGTACTCGATTTGCTGGGACC...

Protein

Download Protein FASTA

443 aa · LXL04_019018|LXL04_019018|OH1004|PROTEIN

MDRIVGGKYKLGRKIGSGSFGEIHLATHVDTFEIVAIKIENNKTKHPQLLYEAKLYNILQGGSGIPAIKWSGVDGEDNILVLDLLGPSLEDLFVYCGRKFQLKTVLMLADQMITRIEYVHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDATTHRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019018`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019018

Location Chr04:22112638-22115709 (+)

Description Similar to CKL3: Casein kinase 1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28880`	Protein kinase involved in blue light responses (e.g. hypocotyl elongation and flowering) by phosphorylating CRY2 to reduce its stability.	No verified direct reference in this release
`At4g28860`	Protein kinase involved in blue light responses (e.g. hypocotyl elongation and flowering) by phosphorylating CRY2 to reduce its stability.	No verified direct reference in this release
`At5g57015`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g26100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g28540`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Arabidopsis casein kinase 1-like 6 contains a microtubule-binding domain and affects the organization of cortical microtubules,2008 · DOI: 10.1104/pp.108.129346 Versatile casein kinase 1: multiple locations and functions.2009 · DOI: 10.1104/pp.108.129346

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019018 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051510 regulation of unidimensional cell growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT4G26100

ath:AT4G28540

ath:AT4G28860

ath:AT4G28880

ath:AT5G57015

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.587

Rank 1 · LXL04_019018 · OH-1004

Nucleus0.355

Rank 2 · LXL04_019018 · OH-1004

Mitochondrion0.095

Rank 3 · LXL04_019018 · OH-1004

Cell membrane0.081

Rank 4 · LXL04_019018 · OH-1004

Endoplasmic reticulum0.041

Rank 5 · LXL04_019018 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase9-227 aa

PF07714.24PK_Tyr_Ser-Thr10-266 aa

PF17667.8Pkinase_fungal109-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019018	`PF00069.32`	Pkinase	9	227	6.3e-27	95.3
LXL04_019018	`PF07714.24`	PK_Tyr_Ser-Thr	10	266	1.2e-14	55.0
LXL04_019018	`PF17667.8`	Pkinase_fungal	109	206	1.6e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z18`	Arabidopsis thaliana	Casein kinase 1-like protein 3	77.151%	Swiss-Prot	strong database homology
`Q8LPI7`	Arabidopsis thaliana	Casein kinase 1-like protein 4	77.534%	Swiss-Prot	strong database homology
`Q8VYK9`	Arabidopsis thaliana	Casein kinase 1-like protein 12	75.394%	Swiss-Prot	strong database homology
`P42158`	Arabidopsis thaliana	Casein kinase 1-like protein 1	73.502%	Swiss-Prot	strong database homology
`Q8LPJ1`	Arabidopsis thaliana	Casein kinase 1-like protein 6	72.136%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card