LXL04_018964 | RubberDandelionOmics

Gene overview

LXL04_018964

Reference: OH-1004 Chr: Chr04 Coordinates: 20464508-20467183 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1905 bp · LXL04_018964|LXL04_018964|OH1004|cDNA

ATGACATCGTTGAAAGACATTGGCAAGCTGATGAATGGATTGTCCCTAGTCGCCAAGGAGGCCATGAGGCGAGGCGATATCGATAAGCGAGACTTGCAATCCCTAATCGAGCGAGCCATCTTATCAGCCACCGACATATCCGGTCTCACTAAAGGCGAGGTTCGCAATTTCACGATTACCGGTACCAAAGCCATTGCTGATACGGACGGTATCAAACAAGACAGCAGCGTGGTCTATTTTGGGGAGGAGGTAGCACCCTC...

CDS

Download CDS FASTA

1905 bp · LXL04_018964|LXL04_018964|OH1004|CDS

ATGACATCGTTGAAAGACATTGGCAAGCTGATGAATGGATTGTCCCTAGTCGCCAAGGAGGCCATGAGGCGAGGCGATATCGATAAGCGAGACTTGCAATCCCTAATCGAGCGAGCCATCTTATCAGCCACCGACATATCCGGTCTCACTAAAGGCGAGGTTCGCAATTTCACGATTACCGGTACCAAAGCCATTGCTGATACGGACGGTATCAAACAAGACAGCAGCGTGGTCTATTTTGGGGAGGAGGTAGCACCCTC...

Protein

Download Protein FASTA

634 aa · LXL04_018964|LXL04_018964|OH1004|PROTEIN

MTSLKDIGKLMNGLSLVAKEAMRRGDIDKRDLQSLIERAILSATDISGLTKGEVRNFTITGTKAIADTDGIKQDSSVVYFGEEVAPSYTSVAFSSDNTLSPTTSDQNTPNETNFDSQRPFYSPTLIYDNGNVDVGARVNHPLNVAEREGGIVIPPAPLDSDAAAATGEGKAVRLTDSPPKAPTITKQRRRRERKVPSTPFSRALGFAGLGAGLAWGTVQESAKRLVFGTTKLQDNQSATSPFLSEKNAERLALALCRMRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018964`
TK1151 ID	TkA05G005560
OH-1004 ID	LXL04_018964
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 59.464 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018964

Location Chr04:20464508-20467183 (-)

Description Similar to ABC1: Protein ABC transporter 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01660`	Atypical kinase involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018964 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0010224 response to UV-B Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0016310 phosphorylation Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G01660

dre:437001

dre:799071

rno:308453

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.764

Rank 1 · LXL04_018964 · OH-1004

Plastid0.157

Rank 2 · LXL04_018964 · OH-1004

Cytoplasm0.097

Rank 3 · LXL04_018964 · OH-1004

Nucleus0.051

Rank 4 · LXL04_018964 · OH-1004

Cell membrane0.031

Rank 5 · LXL04_018964 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109.23ABC1288-528 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018964	`PF03109.23`	ABC1	288	528	2.1e-72	244.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SBB2`	Arabidopsis thaliana	Protein ABC transporter 1, mitochondrial	60.748%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card