Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1479 bp · LXL04_018909|LXL04_018909|OH1004|cDNA
ATGGCGATGGTTCATGCATATCGTCGAGGTGGATCGGTAATTGTGGCAGATTCATTACGTTTCACGACGAGCTGGAGACATTTTTCGACGGGGTTCAGAGAGGAAAGAGATACGTTTGGACCAATTCAAGTCCCATCTGATAAGTTATGGGGAGCTCAAACACAAAGATCTTTGCAGAATTTCGAAATCGGAGGCGACCGTGAAAGAATGCCAGAACCAATCATCCGTTCATTTGGAATCCTTAAGAAATGCGCTGCCAA...
1479 bp · LXL04_018909|LXL04_018909|OH1004|CDS
ATGGCGATGGTTCATGCATATCGTCGAGGTGGATCGGTAATTGTGGCAGATTCATTACGTTTCACGACGAGCTGGAGACATTTTTCGACGGGGTTCAGAGAGGAAAGAGATACGTTTGGACCAATTCAAGTCCCATCTGATAAGTTATGGGGAGCTCAAACACAAAGATCTTTGCAGAATTTCGAAATCGGAGGCGACCGTGAAAGAATGCCAGAACCAATCATCCGTTCATTTGGAATCCTTAAGAAATGCGCTGCCAA...
Protein
Download Protein FASTA492 aa · LXL04_018909|LXL04_018909|OH1004|PROTEIN
MAMVHAYRRGGSVIVADSLRFTTSWRHFSTGFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRSFGILKKCAAKVNMEYGLDPSIGKAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVMHIAAATEINSRLIPKLKQLHTSLQSKTNEFSDIVKIGRTHTQDATPLTLGQEFSGYTTQVKYGIERVLCTLPRMYQLAQGGTAV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018909 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018909 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:19957533-19960654 (-) | |||||||||
| Description | Similar to FUM2: Fumarate hydratase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000050 urea cycle Biological Process GO:0006099 tricarboxylic acid cycle Biological Process GO:0006106 fumarate metabolic process Biological Process GO:0006108 malate metabolic process Biological Process GO:0006281 DNA repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006525 arginine metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0009631 cold acclimation Biological Process GO:0010109 regulation of photosynthesis Biological Process GO:0042128 nitrate assimilation Biological Process GO:0048868 pollen tube development Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G47510 ath:AT5G50950 dre:393938 rno:24368 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00206.26Lyase_140-370 aaPF10415.15FumaraseC_C436-488 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_018909 | PF00206.26 | Lyase_1 | 40 | 370 | 6.8e-116 | 387.8 |
| LXL04_018909 | PF10415.15 | FumaraseC_C | 436 | 488 | 1.7e-24 | 86.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.