LXL04_018875 | RubberDandelionOmics

Gene overview

LXL04_018875

Reference: OH-1004 Chr: Chr04 Coordinates: 19476043-19479909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1470 bp · LXL04_018875|LXL04_018875|OH1004|cDNA

ATGAAGACTACGATTTTGAAGAGGAAGAGGAGCGGTAGTAGCAGAAAGGAAACGCAGAAGAGGATGAAAGGTTCGCTGGCTAGACACTTATCGGCTCAGCTAGGTCAAATCTCTTTCAAGCCGCCGCTTCCTCAGAATAGTAACAATCCTTCGCGGTTTCAGAATCTTCCGGATTACGAGGCTCCCGATACATCGGAATCAGCCCCGTCTACATCGTCGTTTCCGTCGGCGACGGTTCTAGATTTCGATACCGATGTCAA...

CDS

Download CDS FASTA

1470 bp · LXL04_018875|LXL04_018875|OH1004|CDS

ATGAAGACTACGATTTTGAAGAGGAAGAGGAGCGGTAGTAGCAGAAAGGAAACGCAGAAGAGGATGAAAGGTTCGCTGGCTAGACACTTATCGGCTCAGCTAGGTCAAATCTCTTTCAAGCCGCCGCTTCCTCAGAATAGTAACAATCCTTCGCGGTTTCAGAATCTTCCGGATTACGAGGCTCCCGATACATCGGAATCAGCCCCGTCTACATCGTCGTTTCCGTCGGCGACGGTTCTAGATTTCGATACCGATGTCAA...

Protein

Download Protein FASTA

489 aa · LXL04_018875|LXL04_018875|OH1004|PROTEIN

MKTTILKRKRSGSSRKETQKRMKGSLARHLSAQLGQISFKPPLPQNSNNPSRFQNLPDYEAPDTSESAPSTSSFPSATVLDFDTDVNVDEKNFILSQDFFCTPDYITPEAPPLPVTLGCDKMEELPCPRSPEKLKSVRSKRHREAFLNLEEDITEETETDNQPVTEPQVSRQGYVSQSAVALRCRVMPPPCMKNPYIKGSSDNDIDPFGDRRSKCAVFLPAAFSGDGLSRYRTDFHEIKQIGTGNFSCVFKALKRIDGCM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018875`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018875

Location Chr04:19476043-19479909 (-)

Description Similar to WEE1: Wee1-like protein kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02970`	Cell cycle regulatory kinase that is not rate-limiting for cycle progression under normal growth conditions.	A WEE1 homologue from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-002-0815-4 Diverse phosphoregulatory mechanisms controlling cyclin-dependent kinase-activating kinases in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2006.02820.x Arabidopsis WEE1 kinase controls cell cycle arrest in response to activation of the DNA integrity checkpoint.2007 · DOI: 10.1105/tpc.106.045047

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0135300`	Wee1-like protein kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018875 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000076 DNA replication checkpoint signaling Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0045786 negative regulation of cell cycle Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0060631 regulation of meiosis I Biological Process

GO:1902750 negative regulation of cell cycle G2/M phase transition Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02970

dosa:Os02g0135300

dre:327471

xla:398396

xla:399355

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.586

Rank 1 · LXL04_018875 · OH-1004

Cytoplasm0.487

Rank 2 · LXL04_018875 · OH-1004

Mitochondrion0.063

Rank 3 · LXL04_018875 · OH-1004

Cell membrane0.047

Rank 4 · LXL04_018875 · OH-1004

Endoplasmic reticulum0.033

Rank 5 · LXL04_018875 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase235-477 aa

PF07714.24PK_Tyr_Ser-Thr238-475 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018875	`PF00069.32`	Pkinase	235	477	7.1e-49	167.3
LXL04_018875	`PF07714.24`	PK_Tyr_Ser-Thr	238	475	2.1e-24	86.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L4H0`	Arabidopsis thaliana	Wee1-like protein kinase	57.143%	Swiss-Prot	strong database homology
`Q6Z829`	Oryza sativa subsp. japonica	Wee1-like protein kinase	57.412%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card