LXL04_018869 | RubberDandelionOmics

Gene overview

LXL04_018869

Reference: OH-1004 Chr: Chr04 Coordinates: 19402533-19412611 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3026 bp · LXL04_018869|LXL04_018869|OH1004|cDNA

ATGGTGGGGAGAAGGAAGCCTCTCGTGCTTTCTTCTACAAAATCACTTCTCAACTCCGTCCTCAATTCATCCgataaagaaaaaataaatgGAATTCACGGTGCTCCGATTAAAAAACACTCCGTCGACGACGACGACGGCGATGGTGATGCACCGACGATGTTGCAGCTGCGTGCGGGTATTCTTAGATTGTCGGAGGACAAATTAGGCGACAAGGTTACTTCCCTCGACTATGCTGCCGTGATTGGACTCTCTACTTC...

CDS

Download CDS FASTA

2856 bp · LXL04_018869|LXL04_018869|OH1004|CDS

ATGGTGGGGAGAAGGAAGCCTCTCGTGCTTTCTTCTACAAAATCACTTCTCAACTCCGTCCTCAATTCATCCGATAAAGAAAAAATAAATGGAATTCACGGTGCTCCGATTAAAAAACACTCCGTCGACGACGACGACGGCGATGGTGATGCACCGACGATGTTGCAGCTGCGTGCGGGTATTCTTAGATTGTCGGAGGACAAATTAGGCGACAAGGTTACTTCCCTCGACTATGCTGCCGTGATTGGACTCTCTACTTC...

Protein

Download Protein FASTA

951 aa · LXL04_018869|LXL04_018869|OH1004|PROTEIN

MVGRRKPLVLSSTKSLLNSVLNSSDKEKINGIHGAPIKKHSVDDDDGDGDAPTMLQLRAGILRLSEDKLGDKVTSLDYAAVIGLSTSLLKKLLITSGSLVIVKNVDSQIQRISQVVALDPPLTDHNTSSNNESLSLDSSNTMLIFPSYTFPTNHHIPLATESAYVSPLLAFNLGLHTSCLRLLLHHGETKLASLFDTKQETEVNNDFSVNLDIKPLTKSPRYASHLRASFVKIPECGTIGGLLGTSSIEAENRQEKIDQA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018869`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018869

Location Chr04:19402533-19412611 (+)

Description Similar to PEX6: Peroxisome biogenesis protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03000`	Component of the PEX1-PEX6 AAA ATPase complex, a protein dislocase complex that mediates the ATP-dependent extraction of the PEX5 receptor from peroxisomal membranes, an essential step for PEX5 recycling.	An Arabidopsis indole-3-butyric acid-response mutant defective in PEROXIN6, an apparent ATPase implicated in peroxisomal function.2004 · DOI: 10.1073/pnas.0304368101 Functional classification of Arabidopsis peroxisome biogenesis factors proposed from analyses of knockdown mutants.2007 · DOI: 10.1093/pcp/pcm053 Jasmonate biosynthesis in Arabidopsis thaliana requires peroxisomal beta-oxidation enzymes--additional proof by properties of pex6 and aim1.2007 · DOI: 10.1016/j.phytochem.2007.04.024 Peroxisome-associated matrix protein degradation in Arabidopsis.2009 · DOI: 10.1073/pnas.0811329106 Reducing PEX13 expression ameliorates physiological defects of late-acting peroxin mutants.2011 · DOI: 10.1111/j.1600-0854.2010.01136.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018869 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006625 protein targeting to peroxisome Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016561 protein import into peroxisome matrix, translocation Biological Process

GO:0016562 protein import into peroxisome matrix, receptor recycling Biological Process

GO:0043335 protein unfolding Biological Process

GO:0050821 protein stabilization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G03000

ddi:DDB_G0292788

hsa:5190

rno:117265

yli:2909504

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.425

Rank 1 · LXL04_018869 · OH-1004

Mitochondrion0.258

Rank 2 · LXL04_018869 · OH-1004

Cytoplasm0.211

Rank 3 · LXL04_018869 · OH-1004

Nucleus0.105

Rank 4 · LXL04_018869 · OH-1004

Plastid0.067

Rank 5 · LXL04_018869 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03215.22Rad17364-431 aa

PF00004.36AAA381-533 aa

PF13191.13AAA_16660-702 aa

PF05496.19RuvB_N671-705 aa

PF00004.36AAA672-804 aa

PF17862.8AAA_lid_3828-862 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018869	`PF03215.22`	Rad17	364	431	3.1e-06	28.0
LXL04_018869	`PF00004.36`	AAA	381	533	2.7e-65	219.4
LXL04_018869	`PF13191.13`	AAA_16	660	702	5.7e-10	40.7
LXL04_018869	`PF05496.19`	RuvB_N	671	705	2.2e-07	31.5
LXL04_018869	`PF00004.36`	AAA	672	804	2.7e-65	219.4
LXL04_018869	`PF17862.8`	AAA_lid_3	828	862	2.2e-07	31.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY16`	Arabidopsis thaliana	Peroxisomal ATPase PEX6	61.820%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card