LXL04_018836 | RubberDandelionOmics

Gene overview

LXL04_018836

Reference: OH-1004 Chr: Chr04 Coordinates: 18936579-18937715 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1137 bp · LXL04_018836|LXL04_018836|OH1004|cDNA

ATGTTGTTTCACAGCCAAGCTATTTCTTCTCAATTCAACGCATCTAGAACCTCGACTACATTTAGGTTATGGATTCAATTCACCGCTTCAATTTCAAGTCTGAAAGTAGTTTGGCGTAGAGACCAGAAGCTAGACCAAGCAATCGAGAACGATAAAGCATGGCGACAATGTGCAAAAGTCGTTAAAGAGGTGTTAAATGAACCAGGTAACGTAATCCCTCTTCGGTATTTAGAGAAACGCCGTGAGCGATTACGACTTCC...

CDS

Download CDS FASTA

1137 bp · LXL04_018836|LXL04_018836|OH1004|CDS

ATGTTGTTTCACAGCCAAGCTATTTCTTCTCAATTCAACGCATCTAGAACCTCGACTACATTTAGGTTATGGATTCAATTCACCGCTTCAATTTCAAGTCTGAAAGTAGTTTGGCGTAGAGACCAGAAGCTAGACCAAGCAATCGAGAACGATAAAGCATGGCGACAATGTGCAAAAGTCGTTAAAGAGGTGTTAAATGAACCAGGTAACGTAATCCCTCTTCGGTATTTAGAGAAACGCCGTGAGCGATTACGACTTCC...

Protein

Download Protein FASTA

378 aa · LXL04_018836|LXL04_018836|OH1004|PROTEIN

MLFHSQAISSQFNASRTSTTFRLWIQFTASISSLKVVWRRDQKLDQAIENDKAWRQCAKVVKEVLNEPGNVIPLRYLEKRRERLRLPLKIQTFLSRNPGLFDVYYDRIKPKTEPVKFLKFSDQLQRVLHEEKRIHLENEQLLVAKLCKLLMMSKNNVVSADKLLHVKREFGFPNDILSNLVPKYPEYFKLNANSFLELVSWNPNFAKSVIEQRADNESESTGIKIRPSFNWKLPPGFYIRKEMREWIRDWMELPYISPYT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018836`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018836

Location Chr04:18936579-18937715 (-)

Description Similar to At4g01037: Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01037`	RNA-binding protein involved in group II intron splicing.	No verified direct reference in this release
`At4g33495`	Involved in pre-arranging the maintenance of the active cell proliferation during root primordium development.	No verified direct reference in this release
`At2g39120`	RNA-binding protein involved in group II intron splicing.	A PORR domain protein required for rpl2 and ccmF(C) intron splicing and for the biogenesis of c-type cytochromes in Arabidopsis mitochondria.2012 · DOI: 10.1111/j.1365-313x.2011.04849.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0571100`	RNA-binding protein involved in group II intron splicing.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018836 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0015979 photosynthesis Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G39120

ath:AT4G01037

ath:AT4G33495

dosa:Os05g0571100

osa:4339664

zma:100277394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.650

Rank 1 · LXL04_018836 · OH-1004

Plastid0.212

Rank 2 · LXL04_018836 · OH-1004

Nucleus0.100

Rank 3 · LXL04_018836 · OH-1004

Cytoplasm0.039

Rank 4 · LXL04_018836 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_018836 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11955.14PORR40-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018836	`PF11955.14`	PORR	40	364	3.5e-107	358.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0MFS5`	Arabidopsis thaliana	Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic	34.320%	Swiss-Prot	moderate database homology
`Q689D6`	Arabidopsis thaliana	Protein ROOT PRIMORDIUM DEFECTIVE 1	30.606%	Swiss-Prot	moderate database homology
`Q9ZUZ6`	Arabidopsis thaliana	Protein WHAT'S THIS FACTOR 9, mitochondrial	26.100%	Swiss-Prot	weak database homology
`Q65XL5`	Oryza sativa subsp. japonica	Protein WHAT'S THIS FACTOR 1 homolog, chloroplastic	33.429%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card