LXL04_018829 | RubberDandelionOmics

Gene overview

LXL04_018829

Reference: OH-1004 Chr: Chr04 Coordinates: 18831284-18834126 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1261 bp · LXL04_018829|LXL04_018829|OH1004|cDNA

ATGAGCACCACTATACACATTTCTAATGGAAATGAAGCTTCTCCTAACAAGGAGAAGCAAAATAAATCATTTTTCATTTCAAATGTTTGGCATTTTATAGGCAAACATCGCGAACAACAACATGCCAAAAAAGTTATTCATTGTATCAAAGTTGGAACCGCCTTGGTTTTAGTTTCGCTTCTCTATCTCCTTGATCCTCTTTTTAAGCAAGTTGGAGAAAATGCTATGTGGGCTATCATGACCGTTGTGGTTGTCTATGA...

CDS

Download CDS FASTA

1257 bp · LXL04_018829|LXL04_018829|OH1004|CDS

ATGAGCACCACTATACACATTTCTAATGGAAATGAAGCTTCTCCTAACAAGGAGAAGCAAAATAAATCATTTTTCATTTCAAATGTTTGGCATTTTATAGGCAAACATCGCGAACAACAACATGCCAAAAAAGTTATTCATTGTATCAAAGTTGGAACCGCCTTGGTTTTAGTTTCGCTTCTCTATCTCCTTGATCCTCTTTTTAAGCAAGTTGGAGAAAATGCTATGTGGGCTATCATGACCGTTGTGGTTGTCTATGA...

Protein

Download Protein FASTA

418 aa · LXL04_018829|LXL04_018829|OH1004|PROTEIN

MSTTIHISNGNEASPNKEKQNKSFFISNVWHFIGKHREQQHAKKVIHCIKVGTALVLVSLLYLLDPLFKQVGENAMWAIMTVVVVYDFYAGATLSKGLLRGIGTILGGGLGYLTAILAEEFGKTGNIIFVGTSVFIFGAVATYYRMIPSIKKTYDYGFLIFILTFNLVAVSGLRADKILELARERLTTIGMGFSVCIITSLLIFPMWASDELHNSTSSKFAKLASCIEECMEVYFDASEKDRRKSIDVSGCKTILHSKSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018829`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018829

Location Chr04:18831284-18834126 (+)

Description Similar to ALMT13: Aluminum-activated malate transporter 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46600`	Malate transporter.	No verified direct reference in this release
`At5g46610`	Malate transporter.	No verified direct reference in this release
`At4g17970`	Malate-sensitive anion transporter permeable to chloride, nitrate, sulfate and malate.	Closing plant stomata requires a homolog of an aluminum-activated malate transporter.2010 · DOI: 10.1093/pcp/pcq016 AtALMT12 represents an R-type anion channel required for stomatal movement in Arabidopsis guard cells.2010 · DOI: 10.1111/j.1365-313x.2010.04302.x
`At1g08440`	Malate transporter.	No verified direct reference in this release
`At4g00910`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018829 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010118 stomatal movement Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0008509 monoatomic anion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G08440

ath:AT4G17970

ath:AT5G46600

ath:AT5G46610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.820

Rank 1 · LXL04_018829 · OH-1004

Endoplasmic reticulum0.125

Rank 2 · LXL04_018829 · OH-1004

Cytoplasm0.057

Rank 3 · LXL04_018829 · OH-1004

Lysosome / Vacuole0.049

Rank 4 · LXL04_018829 · OH-1004

Nucleus0.025

Rank 5 · LXL04_018829 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744.15ALMT40-361 aa

PF13515.13FUSC_270-197 aa

PF04632.19FUSC73-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018829	`PF11744.15`	ALMT	40	361	2.1e-117	393.7
LXL04_018829	`PF13515.13`	FUSC_2	70	197	1.6e-11	45.1
LXL04_018829	`PF04632.19`	FUSC	73	232	1.4e-10	41.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS23`	Arabidopsis thaliana	Aluminum-activated malate transporter 13	41.962%	Swiss-Prot	moderate database homology
`Q9LS22`	Arabidopsis thaliana	Aluminum-activated malate transporter 14	40.947%	Swiss-Prot	moderate database homology
`O49696`	Arabidopsis thaliana	Aluminum-activated malate transporter 12	42.169%	Swiss-Prot	moderate database homology
`Q9SJE8`	Arabidopsis thaliana	Aluminum-activated malate transporter 2	37.629%	Swiss-Prot	moderate database homology
`O23086`	Arabidopsis thaliana	Aluminum-activated malate transporter 10	36.232%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card