LXL04_018801 | RubberDandelionOmics

Gene overview

LXL04_018801

Reference: OH-1004 Chr: Chr04 Coordinates: 18446030-18448534 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_018801|LXL04_018801|OH1004|cDNA

TGTTAAAAggtaaaagaaaaaaaaaatataaccACGAGAAAAAGAATATAGACATATTGAGTATTGACTGCCTCTGCGCTCTATCTCCACTTCAACGCCGCAGGGATTTCTTTCGCGCCCTTCAATCGCCGATCGCTACCTGAAAACCTAAAGGAGATGGAATCAATTAGTCCAGTTCCGAAGGGGGGTGTCGTATGTCAGACGTGCGGTGATAAAGGATTCACCAATGCTTTTGTTTACTGTGTTAAGTGCTTGGAATA...

CDS

Download CDS FASTA

1023 bp · LXL04_018801|LXL04_018801|OH1004|CDS

TTGACTGCCTCTGCGCTCTATCTCCACTTCAACGCCGCAGGGATTTCTTTCGCGCCCTTCAATCGCCGATCGCTACCTGAAAACCTAAAGGAGATGGAATCAATTAGTCCAGTTCCGAAGGGGGGTGTCGTATGTCAGACGTGCGGTGATAAAGGATTCACCAATGCTTTTGTTTACTGTGTTAAGTGCTTGGAATATGTCATTCACAGGTACTGCTTAAAGGTAATGCCAAACACATTCACGGAGGCGGTCATTTGGTA...

Protein

Download Protein FASTA

340 aa · LXL04_018801|LXL04_018801|OH1004|PROTEIN

MTASALYLHFNAAGISFAPFNRRSLPENLKEMESISPVPKGGVVCQTCGDKGFTNAFVYCVKCLEYVIHRYCLKVMPNTFTEAVIWYCETCKPAVQNQVKSSPSHKNIDPIWSDTSSSDSDSSSISCSNWKEFDEWQARISQQNHRIDRIIDDMVISYPSLILGDNLFTPKKESDIVEETKEVLSQLPKFENIKQDDFYVHAQPIIDPVWRGSLSVGDDIFEGLVGHLSNKACGKVSEEANIMPSLLHLQMHPETPLWPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018801`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018801

Location Chr04:18446030-18448534 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g43770`	Together with AIPP3/BDT1, cooperates to form a BAH-PHD bivalent histone reader complex able to read histone H3 lysine 27 trimethylation (H3K27me3) histone marks in order to regulate transcription, especially to prevent early flowering; promotes AIPP3/BDT1 binding to H3K27me3.	A histone H3K27me3 reader cooperates with a family of PHD finger-containing proteins to regulate flowering time in Arabidopsis.2021 · DOI: 10.1111/jipb.13067
`At5g16680`	Together with AIPP2 and AIPP3/BDT1, cooperates to form a BAH-PHD bivalent histone reader complex able to read histone H3 lysine 27 trimethylation (H3K27me3) and low-methylated H3K4 histone marks in order to regulate transcription, especially to prevent early flowering; promotes AIPP3/BDT1 binding to H3K27me3.	Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis.2020 · DOI: 10.1038/s41467-020-20089-0
`At3g02890`	Together with AIPP3/BDT1 and PAIPP2, cooperates to form a BAH-PHD bivalent histone reader complex able to read histone H3 lysine 27 trimethylation (H3K27me3) and low-methylated H3K4 histone marks in order to regulate transcription, especially to prevent early flowering; promotes AIPP3/BDT1 binding to H3K27me3.	A protein complex regulates RNA processing of intronic heterochromatin-containing genes in Arabidopsis .2017 · DOI: 10.1073/pnas.1710683114 Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis.2020 · DOI: 10.1038/s41467-020-20089-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018801 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0042393 histone binding Molecular Function

GO:0061628 histone H3K27me3 reader activity Molecular Function

GO:0140566 histone reader activity Molecular Function

KEGG gene cross-reference

ath:AT1G43770

ath:AT5G16680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.780

Rank 1 · LXL04_018801 · OH-1004

Cytoplasm0.261

Rank 2 · LXL04_018801 · OH-1004

Cell membrane0.070

Rank 3 · LXL04_018801 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_018801 · OH-1004

Golgi apparatus0.021

Rank 5 · LXL04_018801 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23121.2SPOC_AIPP2210-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018801	`PF23121.2`	SPOC_AIPP2	210	332	8.5e-36	123.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H578`	Arabidopsis thaliana	PHD finger-containing protein 1	40.136%	Swiss-Prot	weak database homology
`F4KE59`	Arabidopsis thaliana	Protein PARALOG OF AIPP2	33.333%	Swiss-Prot	weak database homology
`F4IYH6`	Arabidopsis thaliana	ASI1-immunoprecipitated protein 2	30.345%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card