LXL04_018795 | RubberDandelionOmics

Gene overview

LXL04_018795

Reference: OH-1004 Chr: Chr04 Coordinates: 18337268-18340861 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · LXL04_018795|LXL04_018795|OH1004|cDNA

ATGGCTTCAAAAACGCAAGAAAGGATGAGCATAACCCTAGTCCTCATGGTCATGGTATGGGGTGGAGCCCAGGCTCAATCGAACACTTGCACAAACACACTCATGGGATTGTCTTCATGCCTAAACTATGTCACGGGAAATCTTGGTAGAGCGGAGAAGGTTGAGCTACCAAAGCAGAAGGCTAGTAAGAGTCCACGAGGTTTCGATGATTTGCTTCCTGGATTTGGAAGTGACGGTCCTGCATCCGGTAGCAGGTCAAA...

CDS

Download CDS FASTA

852 bp · LXL04_018795|LXL04_018795|OH1004|CDS

ATGGCTTCAAAAACGCAAGAAAGGATGAGCATAACCCTAGTCCTCATGGTCATGGTATGGGGTGGAGCCCAGGCTCAATCGAACACTTGCACAAACACACTCATGGGATTGTCTTCATGCCTAAACTATGTCACGGGAAATCTTGGTAGAGCGGAGAAGGTTGAGCTACCAAAGCAGAAGGCTAGTAAGAGTCCACGAGGTTTCGATGATTTGCTTCCTGGATTTGGAAGTGACGGTCCTGCATCCGGTAGCAGGTCAAA...

Protein

Download Protein FASTA

283 aa · LXL04_018795|LXL04_018795|OH1004|PROTEIN

MASKTQERMSITLVLMVMVWGGAQAQSNTCTNTLMGLSSCLNYVTGNLGRAEKVELPKQKASKSPRGFDDLLPGFGSDGPASGSRSNSEPVPVLVRKETSNTMDDPFVVLESASPPITSSQVHSFIDPLETVHKINIPVVSCCSQLSNVVQSQPRCLCSLLNGSAPNIGVTINQTLAISLPGACKVQTPPLNLCNGVANGPASGPANGPVSGPTSSVSSPNAEPTTETPEIEAPTAISTPSVPSGSGSGSKSTPATNNNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018795`
TK1151 ID	TkA08G083360
OH-1004 ID	LXL04_018795
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	68.100
Protein coverage (%)	TK1151 99.490 / OH-1004 99.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018795

Location Chr04:18337268-18340861 (+)

Description Similar to LTPG2: Non-specific lipid transfer protein GPI-anchored 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g48130`	Probable lipid transfer protein.	No verified direct reference in this release
`At1g03103`	Probable lipid transfer protein.	No verified direct reference in this release
`At3g22600`	Lipid transfer protein involved in seed and ovule maturation and development, probably by regulating the fatty acids homeostasis during suberin and sporopollenin biosynthesis or deposition.	Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740
`At4g14815`	Probable lipid transfer protein.	No verified direct reference in this release
`At3g43720`	Lipid transfer protein that, together with LTPG1, binds to lipids and functions as a component of the cuticular lipid export machinery that performs extensive export of intracellular lipids (e.g. C29 alkane) from epidermal cells to the surface to build the cuticular wax layer and silique walls.	Characterization of glycosylphosphatidylinositol-anchored lipid transfer protein 2 (LTPG2) and overlapping function between LTPG/LTPG1 and LTPG2 in cuticular wax export or accumulation in Arabidopsis thaliana.2012 · DOI: 10.1093/pcp/pcs083 Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018795 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0006508 proteolysis Biological Process

GO:0006869 lipid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0009845 seed germination Biological Process

GO:0010214 seed coat development Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G03103

ath:AT2G48130

ath:AT3G22600

ath:AT3G43720

ath:AT4G14815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.339

Rank 1 · LXL04_018795 · OH-1004

Extracellular0.225

Rank 2 · LXL04_018795 · OH-1004

Endoplasmic reticulum0.220

Rank 3 · LXL04_018795 · OH-1004

Cytoplasm0.119

Rank 4 · LXL04_018795 · OH-1004

Nucleus0.084

Rank 5 · LXL04_018795 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_2133-194 aa

PF00234.28Tryp_alpha_amyl138-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018795	`PF14368.12`	LTP_2	133	194	2.6e-15	57.0
LXL04_018795	`PF00234.28`	Tryp_alpha_amyl	138	190	3.6e-08	34.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7EB72`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 15	39.416%	Swiss-Prot	weak database homology
`F4HZB9`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 19	41.600%	Swiss-Prot	weak database homology
`Q9LJ86`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 5	49.367%	Swiss-Prot	weak database homology
`Q2PE59`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 26	37.647%	Swiss-Prot	weak database homology
`Q9LZH5`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 2	30.872%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card