LXL04_018771 | RubberDandelionOmics

Gene overview

LXL04_018771

Reference: OH-1004 Chr: Chr04 Coordinates: 17979295-17983318 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1299 bp · LXL04_018771|LXL04_018771|OH1004|cDNA

ATGTCGAATAATCAGGTGGTGAAATTACGAAGAGAATCGTTAGCGGCATGCATGACATGCCCTATCTGTAAGAAGCTGCTTCGAGATGCTACTACTATCCCCGAATGCCTTCATACGTtCTGCAGGAAATGTATTCATAAGAAGCTCACAGATGATGAGCTTGAATGTTGCCCAATATGCAATATTGACCTGGGATGTGTGCCTTTAGTGAAACTGAGGCCAGATCATTGTTTGCAAGATGTAAGAGGGAAAATATTTCC...

CDS

Download CDS FASTA

1299 bp · LXL04_018771|LXL04_018771|OH1004|CDS

ATGTCGAATAATCAGGTGGTGAAATTACGAAGAGAATCGTTAGCGGCATGCATGACATGCCCTATCTGTAAGAAGCTGCTTCGAGATGCTACTACTATCCCCGAATGCCTTCATACGTTCTGCAGGAAATGTATTCATAAGAAGCTCACAGATGATGAGCTTGAATGTTGCCCAATATGCAATATTGACCTGGGATGTGTGCCTTTAGTGAAACTGAGGCCAGATCATTGTTTGCAAGATGTAAGAGGGAAAATATTTCC...

Protein

Download Protein FASTA

432 aa · LXL04_018771|LXL04_018771|OH1004|PROTEIN

MSNNQVVKLRRESLAACMTCPICKKLLRDATTIPECLHTFCRKCIHKKLTDDELECCPICNIDLGCVPLVKLRPDHCLQDVRGKIFPSKRRRVKAPEIVPSVTIPLRRKERSLSSLVVSTPRVSTQTTMTGKRSKVPPRKKPHGSSFSVEKSVKKEEDDSMEEDHQDSSSSREISNKFTQNHNSSPSSAPSPDKDTKHGKVDMWKPLNYLVEVANRSKSSSKFTSQGSSVKSEPQNTPKSEGQLRKSKGKDQLKRSKFQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018771`
TK1151 ID	TkA08G082370
OH-1004 ID	LXL04_018771
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 95.227 / OH-1004 96.991 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018771

Location Chr04:17979295-17983318 (-)

Description Similar to DRIP2: E3 ubiquitin protein ligase DRIP2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30580`	E3 ubiquitin-protein ligase that acts as a negative regulator of the response to water stress.	Arabidopsis DREB2A-interacting proteins function as RING E3 ligases and negatively regulate plant drought stress-responsive gene expression.2008 · DOI: 10.1105/tpc.107.057380
`At1g06770`	E3 ubiquitin-protein ligase that acts as a negative regulator of the response to water stress.	Arabidopsis DREB2A-interacting proteins function as RING E3 ligases and negatively regulate plant drought stress-responsive gene expression.2008 · DOI: 10.1105/tpc.107.057380
`At3g23060`	Probable E3 ubiquitin protein ligase DRIPH.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018771 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0031519 PcG protein complex Cellular Component

GO:0035102 PRC1 complex Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G06770

ath:AT2G30580

ath:AT3G23060

xla:734550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_018771 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_018771 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_018771 · OH-1004

Mitochondrion0.013

Rank 4 · LXL04_018771 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_018771 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13923.13zf-C3HC4_220-60 aa

PF13445.13zf-RING_UBOX20-56 aa

PF00097.32zf-C3HC420-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018771	`PF13923.13`	zf-C3HC4_2	20	60	1.6e-08	34.9
LXL04_018771	`PF13445.13`	zf-RING_UBOX	20	56	7.5e-07	29.8
LXL04_018771	`PF00097.32`	zf-C3HC4	20	60	3.4e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AY3`	Arabidopsis thaliana	E3 ubiquitin protein ligase DRIP2	46.963%	Swiss-Prot	moderate database homology
`Q9M9Y4`	Arabidopsis thaliana	E3 ubiquitin protein ligase DRIP1	48.471%	Swiss-Prot	moderate database homology
`Q9LS86`	Arabidopsis thaliana	Probable E3 ubiquitin protein ligase DRIPH	46.914%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card