LXL04_018762 | RubberDandelionOmics

Gene overview

LXL04_018762

Reference: OH-1004 Chr: Chr04 Coordinates: 17819029-17820417 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1278 bp · LXL04_018762|LXL04_018762|OH1004|cDNA

ATGATGGGGACGGTGACGTCGCCTCCATCATTAACTCCTCCGAGCTCGATCGATGAAGGATTTCAACCGGGAAACCTAACATTAACTCTGATTCCAGGTCTGCCAGATGATCTAGCAGCTTTGATACTTTCGTTTCTTCCGTTTTCTCACCACGCACGCCTTAGATCCACCTGTAAATTATGGAAACACTTCTTCTCATCGAAAACCCTACTGTCAGTTCGCCGTAACCTCCTCCATTCTTTCAATTTATCTCATCTTAT...

CDS

Download CDS FASTA

1278 bp · LXL04_018762|LXL04_018762|OH1004|CDS

ATGATGGGGACGGTGACGTCGCCTCCATCATTAACTCCTCCGAGCTCGATCGATGAAGGATTTCAACCGGGAAACCTAACATTAACTCTGATTCCAGGTCTGCCAGATGATCTAGCAGCTTTGATACTTTCGTTTCTTCCGTTTTCTCACCACGCACGCCTTAGATCCACCTGTAAATTATGGAAACACTTCTTCTCATCGAAAACCCTACTGTCAGTTCGCCGTAACCTCCTCCATTCTTTCAATTTATCTCATCTTAT...

Protein

Download Protein FASTA

425 aa · LXL04_018762|LXL04_018762|OH1004|PROTEIN

MMGTVTSPPSLTPPSSIDEGFQPGNLTLTLIPGLPDDLAALILSFLPFSHHARLRSTCKLWKHFFSSKTLLSVRRNLLHSFNLSHLICIFPEDPTISSPYVFDPQNLAWCHLPPMPCNPHVYGLCNFTSISHESHLYVLGGSLFDTRSFPLDRPSPSSASFRFDFATNSWESLSPMLLPRGSFACSAIPDSHQIIVAGGGSRHTMFGAAGSRMSSVEMYDIAANEWVALDGLPRFRAGCVGFMVGNENNKKEFWVMGGYG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018762`
TK1151 ID	TkA08G081830
OH-1004 ID	LXL04_018762
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018762

Location Chr04:17819029-17820417 (+)

Description Similar to OR23: F-box/kelch-repeat protein OR23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03030`	F-box/kelch-repeat protein OR23.	No verified direct reference in this release
`At1g67480`	F-box/kelch-repeat protein At1g67480.	No verified direct reference in this release
`At3g63220`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g44130`	F-box/kelch-repeat protein At2g44130.	No verified direct reference in this release
`At1g16250`	F-box/kelch-repeat protein At1g16250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018762 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0080037 negative regulation of cytokinin-activated signaling pathway Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G16250

ath:AT1G67480

ath:AT2G44130

ath:AT3G63220

ath:AT4G03030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.847

Rank 1 · LXL04_018762 · OH-1004

Cytoplasm0.246

Rank 2 · LXL04_018762 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_018762 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_018762 · OH-1004

Mitochondrion0.020

Rank 5 · LXL04_018762 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box32-70 aa

PF12937.13F-box-like32-67 aa

PF24981.2Beta-prop_ATRN-LZTR196-259 aa

PF13415.13Beta-prop_FBX42100-265 aa

PF01344.32Kelch_1125-176 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7128-372 aa

PF13415.13Beta-prop_FBX42326-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018762	`PF00646.39`	F-box	32	70	2.3e-08	34.3
LXL04_018762	`PF12937.13`	F-box-like	32	67	4.5e-06	27.0
LXL04_018762	`PF24981.2`	Beta-prop_ATRN-LZTR1	96	259	3.5e-10	40.3
LXL04_018762	`PF13415.13`	Beta-prop_FBX42	100	265	8.2e-12	45.9
LXL04_018762	`PF01344.32`	Kelch_1	125	176	1e-15	57.6
LXL04_018762	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	128	372	1.5e-11	44.8
LXL04_018762	`PF13415.13`	Beta-prop_FBX42	326	408	8.2e-12	45.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0V7S6`	Arabidopsis thaliana	F-box/kelch-repeat protein OR23	56.039%	Swiss-Prot	strong database homology
`Q9CAG8`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g67480	28.112%	Swiss-Prot	weak database homology
`Q9M1W7`	Arabidopsis thaliana	F-box/kelch-repeat protein SKIP30	27.149%	Swiss-Prot	weak database homology
`O80582`	Arabidopsis thaliana	F-box/kelch-repeat protein At2g44130	22.609%	Swiss-Prot	weak database homology
`Q0WW40`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g16250	25.571%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card