LXL04_018748 | RubberDandelionOmics

Gene overview

LXL04_018748

Reference: OH-1004 Chr: Chr04 Coordinates: 17541944-17544914 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1467 bp · LXL04_018748|LXL04_018748|OH1004|cDNA

ATGGCTGCTCGAAAACTCGCCTTAGGCCTCTTCCTCTGCCTCCTCGGAACCACCGCTCTTGCCACCACACGCTCGCCACGACTCGGCGGCCCTGAGTTCTGCAACCTCCAGCGACTCTCGGCTACCCAGCCTTCTCAACGCCTTGAGTTCGAAGGTGGTTCAATTGAAACATGGGATGTAAATGACGACCAATTTCAATGCGTCGGAGTTGCTCCGATGAGGAAGACTATCCAACCCAACTCTCTTTCTCTTCCAAGCTT...

CDS

Download CDS FASTA

1467 bp · LXL04_018748|LXL04_018748|OH1004|CDS

ATGGCTGCTCGAAAACTCGCCTTAGGCCTCTTCCTCTGCCTCCTCGGAACCACCGCTCTTGCCACCACACGCTCGCCACGACTCGGCGGCCCTGAGTTCTGCAACCTCCAGCGACTCTCGGCTACCCAGCCTTCTCAACGCCTTGAGTTCGAAGGTGGTTCAATTGAAACATGGGATGTAAATGACGACCAATTTCAATGCGTCGGAGTTGCTCCGATGAGGAAGACTATCCAACCCAACTCTCTTTCTCTTCCAAGCTT...

Protein

Download Protein FASTA

488 aa · LXL04_018748|LXL04_018748|OH1004|PROTEIN

MAARKLALGLFLCLLGTTALATTRSPRLGGPEFCNLQRLSATQPSQRLEFEGGSIETWDVNDDQFQCVGVAPMRKTIQPNSLSLPSFHPFPRIVFIEEGEGIIGVHFPGCAETFDTGVTGEQQIERPRRMGQQGQEELQDADSHQKVRRFRRGDIIAIPAGAVHWTYNDGNQEVVAISINDINNPANQLDMQPRSFFLAGGTTSSQSVQGRQRQQRPSLEQQQQGGSFDFLNIFAGFDTELLAEAFNSDPEIVRSMQQPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018748`
TK1151 ID	TkA08G080770
OH-1004 ID	LXL04_018748
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.704 / OH-1004 95.902 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_018748`
Location	Chr04:17541944-17544914 (+)
Description	Similar to 11S globulin seed storage protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018748` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0010431 seed maturation Biological Process GO:0048316 seed development Biological Process GO:0070207 protein homotrimerization Biological Process GO:0042735 endosperm protein body Cellular Component GO:0043245 extraorganismal space Cellular Component GO:0019863 IgE binding Molecular Function GO:0019864 IgG binding Molecular Function GO:0045735 nutrient reservoir activity Molecular Function
KEGG gene cross-reference	jre:108996042 sind:105163414 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.446

Rank 1 · LXL04_018748 · OH-1004

Extracellular0.245

Rank 2 · LXL04_018748 · OH-1004

Endoplasmic reticulum0.200

Rank 3 · LXL04_018748 · OH-1004

Cytoplasm0.120

Rank 4 · LXL04_018748 · OH-1004

Cell membrane0.048

Rank 5 · LXL04_018748 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190.29Cupin_141-199 aa

PF00190.29Cupin_1311-458 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018748	`PF00190.29`	Cupin_1	41	199	9.1e-60	201.3
LXL04_018748	`PF00190.29`	Cupin_1	311	458	9.1e-60	201.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card