LXL04_018743 | RubberDandelionOmics

Gene overview

LXL04_018743

Reference: OH-1004 Chr: Chr04 Coordinates: 17490056-17491249 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_018743|LXL04_018743|OH1004|cDNA

ATGGCCCCTTCCTATGAAGATTCTACTATTTCTAGTTCACGCGCCGACACCATCACCACCACCGCTGCTTTCAAACGCCGGAAACTTCTCGACGATCACTACCTAGACATGATACCGGGACTACCTGATCATATCGCCCAACTTTGTCTTTCTCGTGTTCATCCCTCCATCCTTTCCTCCGTTTGCTGTTCATGGCGGCAGTTTATCTACTCCGCCAGTTTTCCGCCGTTTCACTCTCTTTACACCCTCTCTtctaccac...

CDS

Download CDS FASTA

1194 bp · LXL04_018743|LXL04_018743|OH1004|CDS

ATGGCCCCTTCCTATGAAGATTCTACTATTTCTAGTTCACGCGCCGACACCATCACCACCACCGCTGCTTTCAAACGCCGGAAACTTCTCGACGATCACTACCTAGACATGATACCGGGACTACCTGATCATATCGCCCAACTTTGTCTTTCTCGTGTTCATCCCTCCATCCTTTCCTCCGTTTGCTGTTCATGGCGGCAGTTTATCTACTCCGCCAGTTTTCCGCCGTTTCACTCTCTTTACACCCTCTCTTCTACCAC...

Protein

Download Protein FASTA

397 aa · LXL04_018743|LXL04_018743|OH1004|PROTEIN

MAPSYEDSTISSSRADTITTTAAFKRRKLLDDHYLDMIPGLPDHIAQLCLSRVHPSILSSVCCSWRQFIYSASFPPFHSLYTLSSTTTTTSSGQTSILQLSSFDPVSNQWSVVTPTPYLVHVRLRHPSFIARNLPIQSFSVAGKLVLLAGTSGDLLPAFSHPIIFNPLSKTWSFGPPHLTPRRWCVAGTSRAAVIVASGVGAHYSQTVARSVEKWEFRETDSKHKDSNFGWKNMRYLKDGRLCREAIDAVGCKGKLHMVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018743`
TK1151 ID	TkA08G080570
OH-1004 ID	LXL04_018743
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 90.932 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018743

Location Chr04:17490056-17491249 (+)

Description Similar to SKIP25: F-box/kelch-repeat protein SKIP25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31350`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g24540`	Component of SCF (ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release
`At3g61350`	F-box/kelch-repeat protein SKIP4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018743 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G31350

ath:AT2G24540

ath:AT3G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.870

Rank 1 · LXL04_018743 · OH-1004

Cytoplasm0.163

Rank 2 · LXL04_018743 · OH-1004

Cell membrane0.037

Rank 3 · LXL04_018743 · OH-1004

Endoplasmic reticulum0.033

Rank 4 · LXL04_018743 · OH-1004

Plastid0.025

Rank 5 · LXL04_018743 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GX29`	Arabidopsis thaliana	F-box/kelch-repeat protein SKIP25	44.501%	Swiss-Prot	moderate database homology
`Q8LAW2`	Arabidopsis thaliana	F-box protein AFR	24.324%	Swiss-Prot	weak database homology
`Q9M2C9`	Arabidopsis thaliana	F-box/kelch-repeat protein SKIP4	21.812%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card