LXL04_018684 | RubberDandelionOmics

Gene overview

LXL04_018684

Reference: OH-1004 Chr: Chr04 Coordinates: 16613994-16618465 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2286 bp · LXL04_018684|LXL04_018684|OH1004|cDNA

ATGGTGATGCGATCAGCAGGTAGATGGTATCAtatattaaggaactatcaaTCATCCAAACGAGTACTTAACTCAGTTACTCTATATTCATGCCGGAAAATCAATAATGGTGGATTAATACATAAACAACATACTCATAGGTTTTCATCTGTATCAGAATCATGTAAAAATTCTCCTTCAGAGGCCCTTTTATTATCAACCTTCATCAGATCTAGTCTTAACGAGCTCAAAGGCCCCTCTCATTGTTGGTTAAATAGAAA...

CDS

Download CDS FASTA

2286 bp · LXL04_018684|LXL04_018684|OH1004|CDS

ATGGTGATGCGATCAGCAGGTAGATGGTATCATATATTAAGGAACTATCAATCATCCAAACGAGTACTTAACTCAGTTACTCTATATTCATGCCGGAAAATCAATAATGGTGGATTAATACATAAACAACATACTCATAGGTTTTCATCTGTATCAGAATCATGTAAAAATTCTCCTTCAGAGGCCCTTTTATTATCAACCTTCATCAGATCTAGTCTTAACGAGCTCAAAGGCCCCTCTCATTGTTGGTTAAATAGAAA...

Protein

Download Protein FASTA

761 aa · LXL04_018684|LXL04_018684|OH1004|PROTEIN

MVMRSAGRWYHILRNYQSSKRVLNSVTLYSCRKINNGGLIHKQHTHRFSSVSESCKNSPSEALLLSTFIRSSLNELKGPSHCWLNRNPTTKDLTSKNGVFLVIAGAFLELGHSSTSMFEKVKSLQQRHPSLKVMGFQHCKEVNNDIIRSHLSKLIMSEYITFPILLSNKSFSEKSDKKGYIIFNGMEGPPLLHDNDVNFEILETAIKDLIMMQQKEKPGLLHNLRGTWVKPLDALKEPYLCSPLQNLLLYFPGCIEVDEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018684`
TK1151 ID	TkA08G077940
OH-1004 ID	LXL04_018684
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018684

Location Chr04:16613994-16618465 (-)

Description Similar to SOQ1: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56500`	Required to maintain light harvesting efficiency, especially during nonphotochemical quenching (NPQ) recovery, via the regulation of chlorophyll excited-state lifetime probably by preventing the formation of a slowly reversible form of antenna quenching.	A thioredoxin-like/β-propeller protein maintains the efficiency of light harvesting in Arabidopsis.2013 · DOI: 10.1073/pnas.1305443110

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018684 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010196 nonphotochemical quenching Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042651 thylakoid membrane Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G56500

bta:534327

gga:423903

hsa:374354

mmu:66866

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.348

Rank 1 · LXL04_018684 · OH-1004

Cytoplasm0.182

Rank 2 · LXL04_018684 · OH-1004

Plastid0.170

Rank 3 · LXL04_018684 · OH-1004

Nucleus0.155

Rank 4 · LXL04_018684 · OH-1004

Endoplasmic reticulum0.120

Rank 5 · LXL04_018684 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ10`	Arabidopsis thaliana	Protein SUPPRESSOR OF QUENCHING 1, chloroplastic	46.316%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card