LXL04_018682 | RubberDandelionOmics

Gene overview

LXL04_018682

Reference: OH-1004 Chr: Chr04 Coordinates: 16575681-16577408 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_018682|LXL04_018682|OH1004|cDNA

ATGAAAGCAATGGGTGGGATTGTGATTGTTTTCTCACTTTCTCTTCTGTTCTTACTCTGTGTTAATGTTGGCGTATCATCTGCTGCTCCAGCTACTTCACCTGCTAGTTTATTTTGTTCGGGTATGCAGGTTAACGGTGAGATATACAACCACGAGCAGCTCCGAGAAAGCTTGACCGGTCACAAGTTTAAAACCGGCAGTGATTGTGATGTTATTGCTCATCTAAGGCCGGATCTATTTGGGTGTGCGCTTGCCCATGT...

CDS

Download CDS FASTA

507 bp · LXL04_018682|LXL04_018682|OH1004|CDS

ATGAAAGCAATGGGTGGGATTGTGATTGTTTTCTCACTTTCTCTTCTGTTCTTACTCTGTGTTAATGTTGGCGTATCATCTGCTGCTCCAGCTACTTCACCTGCTAGTTTATTTTGTTCGGGTATGCAGGTTAACGGTGAGATATACAACCACGAGCAGCTCCGAGAAAGCTTGACCGGTCACAAGTTTAAAACCGGCAGTGATTGTGATGTTATTGCTCATCTAAGGCCGGATCTATTTGGGTGTGCGCTTGCCCATGT...

Protein

Download Protein FASTA

168 aa · LXL04_018682|LXL04_018682|OH1004|PROTEIN

MKAMGGIVIVFSLSLLFLLCVNVGVSSAAPATSPASLFCSGMQVNGEIYNHEQLRESLTGHKFKTGSDCDVIAHLRPDLFGCALAHVGVMDMLRFHKFTIGNIWYSPLHNVRRPWEQSFGSQYPPTLLLTADHDDRVVPLHTLKLLAIDEWADSYGFMAKVVGATWID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018682`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_018682`
Location	Chr04:16575681-16577408 (+)
Description	Similar to Prep: Prolyl endopeptidase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018682` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002003 angiotensin maturation Biological Process GO:0006508 proteolysis Biological Process GO:0030163 protein catabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0004175 endopeptidase activity Molecular Function GO:0004181 metallocarboxypeptidase activity Molecular Function GO:0004252 serine-type endopeptidase activity Molecular Function GO:0008233 peptidase activity Molecular Function
KEGG gene cross-reference	bta:286818 hsa:5550 mmu:19072 rno:83471 ssc:445540 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.388

Rank 1 · LXL04_018682 · OH-1004

Lysosome / Vacuole0.233

Rank 2 · LXL04_018682 · OH-1004

Extracellular0.207

Rank 3 · LXL04_018682 · OH-1004

Cytoplasm0.144

Rank 4 · LXL04_018682 · OH-1004

Golgi apparatus0.079

Rank 5 · LXL04_018682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13522.13GATase_642-75 aa

PF13537.12GATase_743-75 aa

PF00326.28Peptidase_S973-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018682	`PF13522.13`	GATase_6	42	75	2.4e-08	34.4
LXL04_018682	`PF13537.12`	GATase_7	43	75	8.9e-08	32.9
LXL04_018682	`PF00326.28`	Peptidase_S9	73	147	4e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card