LXL04_018627 | RubberDandelionOmics

Gene overview

LXL04_018627

Reference: OH-1004 Chr: Chr04 Coordinates: 15778525-15779745 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · LXL04_018627|LXL04_018627|OH1004|cDNA

ATGGGGATCAGATTCATACTCATGGTGAACAAGCAAGGCCAGACCCGTCTTGCACAGTACTACGAATACCTAACCCTAGAAGAACGACGAGCTCTCGAAGGTGAAATTGTTCGCAAGTGCCTCGCTCGTAATGAACAACAGTGTTCATTCGTTGAGCATCGAAACTACAAAATTGTGTATAGACGTTATGCTTCATTGTTCTTTCTAGTTGGAGTTGACAATGAAGAAAATGAGCTTGCAATATTGGAATTCATACATCT...

CDS

Download CDS FASTA

432 bp · LXL04_018627|LXL04_018627|OH1004|CDS

ATGGGGATCAGATTCATACTCATGGTGAACAAGCAAGGCCAGACCCGTCTTGCACAGTACTACGAATACCTAACCCTAGAAGAACGACGAGCTCTCGAAGGTGAAATTGTTCGCAAGTGCCTCGCTCGTAATGAACAACAGTGTTCATTCGTTGAGCATCGAAACTACAAAATTGTGTATAGACGTTATGCTTCATTGTTCTTTCTAGTTGGAGTTGACAATGAAGAAAATGAGCTTGCAATATTGGAATTCATACATCT...

Protein

Download Protein FASTA

143 aa · LXL04_018627|LXL04_018627|OH1004|PROTEIN

MGIRFILMVNKQGQTRLAQYYEYLTLEERRALEGEIVRKCLARNEQQCSFVEHRNYKIVYRRYASLFFLVGVDNEENELAILEFIHLLVETMDRHFGNVCELDIMFHLEKAHFMLEEMVMNGCIVETSKANILAPIQLMDKAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018627`
TK1151 ID	TkA08G072600
OH-1004 ID	LXL04_018627
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018627

Location Chr04:15778525-15779745 (+)

Description Similar to At2g19790: AP-4 complex subunit sigma

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19790`	Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018627 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006605 protein targeting Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005905 clathrin-coated pit Cellular Component

GO:0030124 AP-4 adaptor complex Cellular Component

GO:0031904 endosome lumen Cellular Component

GO:0032588 trans-Golgi network membrane Cellular Component

KEGG gene cross-reference

ath:AT2G19790

bta:618267

ddi:DDB_G0284905

hsa:11154

mmu:11782

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.592

Rank 1 · LXL04_018627 · OH-1004

Golgi apparatus0.324

Rank 2 · LXL04_018627 · OH-1004

Lysosome / Vacuole0.162

Rank 3 · LXL04_018627 · OH-1004

Nucleus0.146

Rank 4 · LXL04_018627 · OH-1004

Cell membrane0.143

Rank 5 · LXL04_018627 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01217.27Clat_adaptor_s3-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018627	`PF01217.27`	Clat_adaptor_s	3	142	8.1e-47	159.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82201`	Arabidopsis thaliana	AP-4 complex subunit sigma	95.070%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card