LXL04_018597 | RubberDandelionOmics

Gene overview

LXL04_018597

Reference: OH-1004 Chr: Chr04 Coordinates: 15340308-15342314 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · LXL04_018597|LXL04_018597|OH1004|cDNA

ATGGGTTTATCCTTCTCACTTTTATCATCAGCTTGGGAAGTAATCTTGCGACATGGATTCCTAGATCTACCATACGATCTTGAAAACCTCGAAAACCGATTACGATCCAATAGCTTCAAAAGACCCGAATCCGGATCCGAATCCGAATCCGAACAATTTTCAACAAATTCACAACATTCAAGTCCTAAAAGCACAAGAAGAAACTCAATCAGTTTAAAAAGCTGTGAACCATTAAAAGTCATGCTTGAAACCACCCTTTC...

CDS

Download CDS FASTA

1623 bp · LXL04_018597|LXL04_018597|OH1004|CDS

ATGGGTTTATCCTTCTCACTTTTATCATCAGCTTGGGAAGTAATCTTGCGACATGGATTCCTAGATCTACCATACGATCTTGAAAACCTCGAAAACCGATTACGATCCAATAGCTTCAAAAGACCCGAATCCGGATCCGAATCCGAATCCGAACAATTTTCAACAAATTCACAACATTCAAGTCCTAAAAGCACAAGAAGAAACTCAATCAGTTTAAAAAGCTGTGAACCATTAAAAGTCATGCTTGAAACCACCCTTTC...

Protein

Download Protein FASTA

540 aa · LXL04_018597|LXL04_018597|OH1004|PROTEIN

MGLSFSLLSSAWEVILRHGFLDLPYDLENLENRLRSNSFKRPESGSESESEQFSTNSQHSSPKSTRRNSISLKSCEPLKVMLETTLSFKNLVQDIRKPEPETSSIESGSKNLLPEPVVFFSPRPVIELNNAATTLQKVYKSYRTRRNLADGAVVAEELWWKALDFAALDRSSVSFFNVEKHETAVSRWARAGTRVAKVGKGLLKDEKAQKLALQHWLEAIDPRHRYGHNLHIYYDLWFESESSQPFFYWLDVGDGKEVNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018597`
TK1151 ID	TkA08G069920
OH-1004 ID	LXL04_018597
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018597

Location Chr04:15340308-15342314 (-)

Description Similar to IQM1: IQ domain-containing protein IQM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33050`	Involved in the modulation of stomatal movement.	AtIQM1, a novel calmodulin-binding protein, is involved in stomatal movement in Arabidopsis.2012 · DOI: 10.1007/s11103-012-9915-0
`At5g57010`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At2g26190`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At3g13600`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release
`At3g58480`	May be involved in biotic and abiotic stress responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018597 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26190

ath:AT3G13600

ath:AT4G33050

ath:AT5G57010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.461

Rank 1 · LXL04_018597 · OH-1004

Nucleus0.339

Rank 2 · LXL04_018597 · OH-1004

Cell membrane0.251

Rank 3 · LXL04_018597 · OH-1004

Plastid0.102

Rank 4 · LXL04_018597 · OH-1004

Endoplasmic reticulum0.063

Rank 5 · LXL04_018597 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30383.1IQM_M280-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018597	`PF30383.1`	IQM_M	280	371	1e-44	151.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82645`	Arabidopsis thaliana	IQ domain-containing protein IQM1	61.067%	Swiss-Prot	strong database homology
`Q058N0`	Arabidopsis thaliana	IQ domain-containing protein IQM5	59.874%	Swiss-Prot	strong database homology
`O64851`	Arabidopsis thaliana	IQ domain-containing protein IQM4	57.636%	Swiss-Prot	strong database homology
`Q9LHN9`	Arabidopsis thaliana	IQ domain-containing protein IQM2	69.203%	Swiss-Prot	moderate database homology
`Q9M2G8`	Arabidopsis thaliana	IQ domain-containing protein IQM6	68.519%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card