LXL04_018571 | RubberDandelionOmics

Gene overview

LXL04_018571

Reference: OH-1004 Chr: Chr04 Coordinates: 14863311-14864122 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_018571|LXL04_018571|OH1004|cDNA

ATGAAGTCTTCATCTGTACTGAGGTTTCAACGCACCAGGTTGACCATCCATGTCATCTCCACTCCATTGATGATGAAGAATGCAGCAGAAATGGAGGAACCCTCGTCATCTCATGACCCAAAGTACAAAGGTGTGCGGAAGAGGAAATGGGGGAAATGGGTGTCGGAGATCCGGCTGCCCAACAGCCGTGAGCGGATCTGGTTAGGCTCGTACGACTCGCCGGAGAAAGCTGCTAGGGCTTTCGATGCGGCGGCGTTCTG...

CDS

Download CDS FASTA

624 bp · LXL04_018571|LXL04_018571|OH1004|CDS

ATGAAGTCTTCATCTGTACTGAGGTTTCAACGCACCAGGTTGACCATCCATGTCATCTCCACTCCATTGATGATGAAGAATGCAGCAGAAATGGAGGAACCCTCGTCATCTCATGACCCAAAGTACAAAGGTGTGCGGAAGAGGAAATGGGGGAAATGGGTGTCGGAGATCCGGCTGCCCAACAGCCGTGAGCGGATCTGGTTAGGCTCGTACGACTCGCCGGAGAAAGCTGCTAGGGCTTTCGATGCGGCGGCGTTCTG...

Protein

Download Protein FASTA

207 aa · LXL04_018571|LXL04_018571|OH1004|PROTEIN

MKSSSVLRFQRTRLTIHVISTPLMMKNAAEMEEPSSSHDPKYKGVRKRKWGKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAAAFCLRGSSAKFNFPDQPPDIPGGRSLSPSEIQAAAAHFANSFTFPAAAPSGSVSDAAVVVEADTTTASLFSPFDYVTNYGMFPEFDDCFMQPPPMDSPPSTDYDEENSEYGEISLDPLFLWSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018571`
TK1151 ID	TkA08G068730
OH-1004 ID	LXL04_018571
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 88.889 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018571

Location Chr04:14863311-14864122 (+)

Description Similar to ERF017: Ethylene-responsive transcription factor ERF017

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19210`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g74930`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g21960`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g31060`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g01250`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018571 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009611 response to wounding Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G01250

ath:AT1G19210

ath:AT1G74930

ath:AT4G31060

ath:AT5G21960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · LXL04_018571 · OH-1004

Cytoplasm0.116

Rank 2 · LXL04_018571 · OH-1004

Cell membrane0.035

Rank 3 · LXL04_018571 · OH-1004

Endoplasmic reticulum0.034

Rank 4 · LXL04_018571 · OH-1004

Plastid0.024

Rank 5 · LXL04_018571 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP240-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018571	`PF00847.27`	AP2	40	91	7.5e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84QC2`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF017	52.381%	Swiss-Prot	strong database homology
`Q9S7L5`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF018	50.000%	Swiss-Prot	strong database homology
`Q9C591`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF016	77.381%	Swiss-Prot	weak database homology
`Q6NLD5`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF015	59.551%	Swiss-Prot	weak database homology
`Q1ECI2`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF023	54.878%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card