LXL04_018563 | RubberDandelionOmics

Gene overview

LXL04_018563

Reference: OH-1004 Chr: Chr04 Coordinates: 14698748-14700924 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1047 bp · LXL04_018563|LXL04_018563|OH1004|cDNA

ATGGAGCAGAGGCAGAGAAACCAAAAGACAGCTCACCAAGAAGAACAGCCACAGCAACAGGATGAACAATTAGACGAAATCCAGCATGGTCCTTTCCCAATCGAACAACTTCAGGCATCTGGAATCGCCGCCATTGACGTAAAGAAGCTGAAAGACGCAGGTCTATGTACAGTTGAATCCGTAGCTTACTCTCCACGAAAAGAGCTTCTCCAAATCAAAGGAATAAGTGAAGCTAAAGTCGACAAAATCATTGAAGCAGC...

CDS

Download CDS FASTA

1047 bp · LXL04_018563|LXL04_018563|OH1004|CDS

ATGGAGCAGAGGCAGAGAAACCAAAAGACAGCTCACCAAGAAGAACAGCCACAGCAACAGGATGAACAATTAGACGAAATCCAGCATGGTCCTTTCCCAATCGAACAACTTCAGGCATCTGGAATCGCCGCCATTGACGTAAAGAAGCTGAAAGACGCAGGTCTATGTACAGTTGAATCCGTAGCTTACTCTCCACGAAAAGAGCTTCTCCAAATCAAAGGAATAAGTGAAGCTAAAGTCGACAAAATCATTGAAGCAGC...

Protein

Download Protein FASTA

348 aa · LXL04_018563|LXL04_018563|OH1004|PROTEIN

MEQRQRNQKTAHQEEQPQQQDEQLDEIQHGPFPIEQLQASGIAAIDVKKLKDAGLCTVESVAYSPRKELLQIKGISEAKVDKIIEAASKLVPLGFTSAGQLHQQRLEIIQISSGSRELDKILDGGIETGSITELYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGNDVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMIVDSATALYRTDFSGRGELSARQMHLAKFLRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018563`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018563

Location Chr04:14698748-14700924 (+)

Description Similar to RAD51: DNA repair protein RAD51 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20850`	Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity.	The Arabidopsis AtRAD51 gene is dispensable for vegetative development but required for meiosis.2004 · DOI: 10.1073/pnas.0404110101

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018563 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000730 DNA recombinase assembly Biological Process

GO:0006259 DNA metabolic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0009314 response to radiation Biological Process

KEGG gene cross-reference

ath:AT5G20850

hsa:5888

sly:544003

zma:541709

zma:541710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.614

Rank 1 · LXL04_018563 · OH-1004

Cytoplasm0.261

Rank 2 · LXL04_018563 · OH-1004

Mitochondrion0.199

Rank 3 · LXL04_018563 · OH-1004

Plastid0.031

Rank 4 · LXL04_018563 · OH-1004

Cell membrane0.025

Rank 5 · LXL04_018563 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14520.13HHH_541-88 aa

PF00154.28RecA_N100-314 aa

PF08423.18Rad51104-346 aa

PF13481.13AAA_25106-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018563	`PF14520.13`	HHH_5	41	88	9.7e-07	29.9
LXL04_018563	`PF00154.28`	RecA_N	100	314	2.5e-12	47.5
LXL04_018563	`PF08423.18`	Rad51	104	346	6.4e-131	435.6
LXL04_018563	`PF13481.13`	AAA_25	106	276	2.9e-09	37.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P94102`	Arabidopsis thaliana	DNA repair protein RAD51 homolog 1	87.931%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card