LXL04_018560 | RubberDandelionOmics

Gene overview

LXL04_018560

Reference: OH-1004 Chr: Chr04 Coordinates: 14668298-14670886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_018560|LXL04_018560|OH1004|cDNA

ATGAAAGACGCTCACGACCAAATCTTTTCATCGCACAAATTGCTGTCAATGGAAGCTCAAGTGGGGATGTCTAGTCACGGCGGAGTCGTGGAGGGCCCTACCGCGGTGAAGTTTTTACAAAAGCAGCAGACGGTGGCGCCGTCTCCTTCCCCACGTCAACACCAACATCAGCAGTCAGCGGAGATAGGCACGGTACCACAGCTTCTAGCTGGCGGTATTGCTGGTGCTTTTAGCAAAACATGCACGGCTCCACTCGCACG...

CDS

Download CDS FASTA

1086 bp · LXL04_018560|LXL04_018560|OH1004|CDS

ATGAAAGACGCTCACGACCAAATCTTTTCATCGCACAAATTGCTGTCAATGGAAGCTCAAGTGGGGATGTCTAGTCACGGCGGAGTCGTGGAGGGCCCTACCGCGGTGAAGTTTTTACAAAAGCAGCAGACGGTGGCGCCGTCTCCTTCCCCACGTCAACACCAACATCAGCAGTCAGCGGAGATAGGCACGGTACCACAGCTTCTAGCTGGCGGTATTGCTGGTGCTTTTAGCAAAACATGCACGGCTCCACTCGCACG...

Protein

Download Protein FASTA

361 aa · LXL04_018560|LXL04_018560|OH1004|PROTEIN

MKDAHDQIFSSHKLLSMEAQVGMSSHGGVVEGPTAVKFLQKQQTVAPSPSPRQHQHQQSAEIGTVPQLLAGGIAGAFSKTCTAPLARLTILFQVQGMHSEVALLTRPCIWNEALRIANEEGFRAFWKGNLVTIAHRLPYTAVNFYAYEQFKKLLKSVPRIGNNSESAAAEACVHFVGGGMSGITAAMATYPLDLVRTRLAAQRSTIYYHGIGHALRTIIRDEGCIGLYKGLGATLLGVGPSIAISFSVYEMLRSNWKLHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018560`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018560

Location Chr04:14668298-14670886 (-)

Description Similar to mcfB: Mitochondrial substrate carrier family protein B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01100`	Mitochondrial adenylate carrier that catalyzes specifically the transport of ATP, ADP and AMP by a counter-exchange mechanism across the inner mitochondrial membrane.	Identification and characterization of ADNT1, a novel mitochondrial adenine nucleotide transporter from Arabidopsis.2008 · DOI: 10.1104/pp.108.130310

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018560 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006839 mitochondrial transport Biological Process

GO:0015866 ADP transport Biological Process

GO:0015867 ATP transport Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0051503 adenine nucleotide transport Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0000295 adenine nucleotide transmembrane transporter activity Molecular Function

GO:0005347 ATP transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ddi:DDB_G0285599

hsa:29957

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.889

Rank 1 · LXL04_018560 · OH-1004

Cytoplasm0.050

Rank 2 · LXL04_018560 · OH-1004

Nucleus0.032

Rank 3 · LXL04_018560 · OH-1004

Plastid0.030

Rank 4 · LXL04_018560 · OH-1004

Cell membrane0.023

Rank 5 · LXL04_018560 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr64-155 aa

PF00153.33Mito_carr172-256 aa

PF00153.33Mito_carr264-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018560	`PF00153.33`	Mito_carr	64	155	1.3e-73	243.5
LXL04_018560	`PF00153.33`	Mito_carr	172	256	1.3e-73	243.5
LXL04_018560	`PF00153.33`	Mito_carr	264	358	1.3e-73	243.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04619`	Arabidopsis thaliana	Mitochondrial adenine nucleotide transporter ADNT1	37.338%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card