LXL04_018545 | RubberDandelionOmics

Gene overview

LXL04_018545

Reference: OH-1004 Chr: Chr04 Coordinates: 14454027-14457435 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · LXL04_018545|LXL04_018545|OH1004|cDNA

ATGGCCGATCAGCTCACCGATGACCAGATCTCAGAGTTTAAGGAAGCCTTCAGCCTATTCGATAAGGATGGCGACGGTTGTATCACAACAAAGGAACTCGGAACAGTGATGAGATCGCTAGGTCAAAATCCAACAGAAGCTGAGCTCCAGGACATGATCAACGAAGTGGATGCAGATGGAAACGGAACCATCGATTTCCCGGAATTTCTAAACCTGATGGCAAGGAAGATGAAGGACACAGACTCCGAGGAAGAATTAAA...

CDS

Download CDS FASTA

1368 bp · LXL04_018545|LXL04_018545|OH1004|CDS

ATGGCCGATCAGCTCACCGATGACCAGATCTCAGAGTTTAAGGAAGCCTTCAGCCTATTCGATAAGGATGGCGACGGTTGTATCACAACAAAGGAACTCGGAACAGTGATGAGATCGCTAGGTCAAAATCCAACAGAAGCTGAGCTCCAGGACATGATCAACGAAGTGGATGCAGATGGAAACGGAACCATCGATTTCCCGGAATTTCTAAACCTGATGGCAAGGAAGATGAAGGACACAGACTCCGAGGAAGAATTAAA...

Protein

Download Protein FASTA

455 aa · LXL04_018545|LXL04_018545|OH1004|PROTEIN

MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMANCCQLCHVEPKLDKFDGTLRTRRMLAGTTPLQYSDTPSAFCPSHIDIHSNYYYRSQMDPDRTTTNTHWCYTCRQLVTLTTQTRLCYECDGGFVQELENILTTTSTTEEQNRQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018545`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018545

Location Chr04:14454027-14457435 (+)

Description Similar to CAM53: Calmodulin-related protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43810`	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+).	ABC transporter PEN3/PDR8/ABCG36 interacts with calmodulin that, like PEN3, is required for Arabidopsis nonhost resistance.2016 · DOI: 10.1111/nph.13582

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018545 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · LXL04_018545 · OH-1004

Nucleus0.301

Rank 2 · LXL04_018545 · OH-1004

Cell membrane0.145

Rank 3 · LXL04_018545 · OH-1004

Endoplasmic reticulum0.138

Rank 4 · LXL04_018545 · OH-1004

Lysosome / Vacuole0.105

Rank 5 · LXL04_018545 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21008.4AIF-17-76 aa

PF00036.39EF-hand_112-40 aa

PF13499.13EF-hand_712-73 aa

PF13405.13EF-hand_612-41 aa

PF14658.13EF-hand_915-75 aa

PF13833.13EF-hand_825-75 aa

PF30551.1CFAP251_C25-127 aa

PF00036.39EF-hand_148-75 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018545	`PF21008.4`	AIF-1	7	76	8.4e-16	59.2
LXL04_018545	`PF00036.39`	EF-hand_1	12	40	2.3e-39	130.7
LXL04_018545	`PF13499.13`	EF-hand_7	12	73	7.1e-39	132.7
LXL04_018545	`PF13405.13`	EF-hand_6	12	41	1.3e-29	99.7
LXL04_018545	`PF14658.13`	EF-hand_9	15	75	1.6e-18	67.6
LXL04_018545	`PF13833.13`	EF-hand_8	25	75	1e-25	89.9
LXL04_018545	`PF30551.1`	CFAP251_C	25	127	1.6e-12	48.1
LXL04_018545	`PF00036.39`	EF-hand_1	48	75	2.3e-39	130.7
LXL04_018545	`PF13202.13`	EF-hand_5	49	73	1.1e-24	85.4
LXL04_018545	`PF23564.2`	EF-hand_FSTL1	77	148	2.7e-08	34.9
LXL04_018545	`PF13499.13`	EF-hand_7	83	147	7.1e-39	132.7
LXL04_018545	`PF21008.4`	AIF-1	84	152	8.4e-16	59.2
LXL04_018545	`PF00036.39`	EF-hand_1	85	112	2.3e-39	130.7
LXL04_018545	`PF13405.13`	EF-hand_6	85	114	1.3e-29	99.7
LXL04_018545	`PF13202.13`	EF-hand_5	86	110	1.1e-24	85.4
LXL04_018545	`PF14658.13`	EF-hand_9	88	148	1.6e-18	67.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59220`	Arabidopsis thaliana	Calmodulin-7	100.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card