LXL04_018499 | RubberDandelionOmics

Gene overview

LXL04_018499

Reference: OH-1004 Chr: Chr04 Coordinates: 13799973-13804469 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3330 bp · LXL04_018499|LXL04_018499|OH1004|cDNA

ATGTCACCTGCACTCGAAGATTTTTTATCCTCATCATCGTCCTCCACACAACGTTCGTTTTTccaaaaccctaaccctagcgCTCAGGGACATTTTACTGATTCAGGTATACTCAATAGTAGTTTCAATCTCATGAGTTCTCGTAAATTTGATTTTGATTGTTCAAATGACGCGGCGGCCACTGTTCGTTCTTCGAGGAGGAAGCACGTAAAAGTGAAGAAACAATCGAGTTGTAATGGTTCAGTGAGTAAAAAACCTTT...

CDS

Download CDS FASTA

3330 bp · LXL04_018499|LXL04_018499|OH1004|CDS

ATGTCACCTGCACTCGAAGATTTTTTATCCTCATCATCGTCCTCCACACAACGTTCGTTTTTCCAAAACCCTAACCCTAGCGCTCAGGGACATTTTACTGATTCAGGTATACTCAATAGTAGTTTCAATCTCATGAGTTCTCGTAAATTTGATTTTGATTGTTCAAATGACGCGGCGGCCACTGTTCGTTCTTCGAGGAGGAAGCACGTAAAAGTGAAGAAACAATCGAGTTGTAATGGTTCAGTGAGTAAAAAACCTTT...

Protein

Download Protein FASTA

1109 aa · LXL04_018499|LXL04_018499|OH1004|PROTEIN

MSPALEDFLSSSSSSTQRSFFQNPNPSAQGHFTDSGILNSSFNLMSSRKFDFDCSNDAAATVRSSRRKHVKVKKQSSCNGSVSKKPFNKAGDTTGFVFNATTSGSVLSSSLGQTGCDGNGERRHDGEVLDANLLRFTMGAGNGKLGNKMGSEEVHNSTNSFQPDRTNFVFGAGDKKADSRKASENVANKIGKLNGMDFVFGMKLNNGVGNSSSSNIGHESGPDGVAFHVSDSESSGAVGRSGINEFMKVKNFTTMADSHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018499`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018499

Location Chr04:13799973-13804469 (+)

Description Similar to DNAJC7: DnaJ homolog subfamily C member 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58620`	Involved in osmotic and salt stress tolerance.	The Arabidopsis tetratricopeptide thioredoxin-like gene family is required for osmotic stress tolerance and male sporogenesis.2012 · DOI: 10.1104/pp.111.188920

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018499 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:1900034 regulation of cellular response to heat Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0016020 membrane Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0001671 ATPase activator activity Molecular Function

KEGG gene cross-reference

ath:AT3G58620

ddi:DDB_G0288639

hsa:7266

mmu:56354

pon:100173101

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.530

Rank 1 · LXL04_018499 · OH-1004

Cytoplasm0.415

Rank 2 · LXL04_018499 · OH-1004

Cell membrane0.070

Rank 3 · LXL04_018499 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_018499 · OH-1004

Golgi apparatus0.034

Rank 5 · LXL04_018499 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25575.1TPR_BSK1_C820-919 aa

PF00226.37DnaJ984-1054 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018499	`PF25575.1`	TPR_BSK1_C	820	919	1.2e-07	32.3
LXL04_018499	`PF00226.37`	DnaJ	984	1054	1.6e-15	57.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JR9`	Arabidopsis thaliana	TPR repeat-containing thioredoxin TTL4	28.784%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card