LXL04_018466 | RubberDandelionOmics

Gene overview

LXL04_018466

Reference: OH-1004 Chr: Chr04 Coordinates: 13358127-13359176 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1050 bp · LXL04_018466|LXL04_018466|OH1004|cDNA

ATGGCCACATTTCCCAGCTCAAGGTACTTCACGGTCCTCTTTTTGTTCACCCTTTCCTTCAAATCCCTAATCGCAGTCGCCGAttcctctttttctttcaaGAATTTTGGTTGGAATACGAGTTTTGAGTCTGTTCTTGCACTTTATGGTGATGCGAAAGCTGTTAGTGATAATTGGTCTTTACAACTCACTGCTCCGTCGGTCTCGAGTGCTGGTCGAGTGATTTACAAAAACCCTGTTAAGTTCTATGGCGGGATCCC...

CDS

Download CDS FASTA

1050 bp · LXL04_018466|LXL04_018466|OH1004|CDS

ATGGCCACATTTCCCAGCTCAAGGTACTTCACGGTCCTCTTTTTGTTCACCCTTTCCTTCAAATCCCTAATCGCAGTCGCCGATTCCTCTTTTTCTTTCAAGAATTTTGGTTGGAATACGAGTTTTGAGTCTGTTCTTGCACTTTATGGTGATGCGAAAGCTGTTAGTGATAATTGGTCTTTACAACTCACTGCTCCGTCGGTCTCGAGTGCTGGTCGAGTGATTTACAAAAACCCTGTTAAGTTCTATGGCGGGATCCC...

Protein

Download Protein FASTA

349 aa · LXL04_018466|LXL04_018466|OH1004|PROTEIN

MATFPSSRYFTVLFLFTLSFKSLIAVADSSFSFKNFGWNTSFESVLALYGDAKAVSDNWSLQLTAPSVSSAGRVIYKNPVKFYGGIPKKLVSFSTYFSFSISSQSENGDGLAFVVFSDGYPVDLFEDNGSFGLPNGDNLKFLSVEFDTSMDEKYGDMNENHIGIDLSSFVSLKATNLSSFNLGLQSGNRLQAWIDYQSNSRRLEVRLSEYGETRPVDPLLFHRIDLPKIWPGNEGFFVGLTSSNRNSSQLCNLYSWSFKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018466`
TK1151 ID	TkA08G062900
OH-1004 ID	LXL04_018466
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.200
Protein coverage (%)	TK1151 97.814 / OH-1004 50.430 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018466

Location Chr04:13358127-13359176 (+)

Description Similar to LECRK82: L-type lectin-domain containing receptor kinase VIII.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03140`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release
`At5g55830`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release
`At5g42120`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At3g53380`	L-type lectin-domain containing receptor kinase VIII.1.	No verified direct reference in this release
`At4g02420`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018466 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G53380

ath:AT4G02420

ath:AT5G03140

ath:AT5G42120

ath:AT5G55830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.575

Rank 1 · LXL04_018466 · OH-1004

Endoplasmic reticulum0.147

Rank 2 · LXL04_018466 · OH-1004

Extracellular0.110

Rank 3 · LXL04_018466 · OH-1004

Cytoplasm0.088

Rank 4 · LXL04_018466 · OH-1004

Lysosome / Vacuole0.084

Rank 5 · LXL04_018466 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139.27Lectin_legB29-270 aa

PF18483.9Lectin_L-type_dom40-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018466	`PF00139.27`	Lectin_legB	29	270	1.1e-55	189.6
LXL04_018466	`PF18483.9`	Lectin_L-type_dom	40	247	1.1e-06	29.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYX1`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase VIII.2	34.363%	Swiss-Prot	moderate database homology
`Q9FHG4`	Arabidopsis thaliana	Probable L-type lectin-domain containing receptor kinase S.7	33.083%	Swiss-Prot	moderate database homology
`Q9FHX3`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase S.6	37.069%	Swiss-Prot	moderate database homology
`Q9LFH9`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase VIII.1	33.871%	Swiss-Prot	moderate database homology
`O81291`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.4	30.337%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card