LXL04_018434 | RubberDandelionOmics

Gene overview

LXL04_018434

Reference: OH-1004 Chr: Chr04 Coordinates: 12923652-12930063 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3966 bp · LXL04_018434|LXL04_018434|OH1004|cDNA

ATGGCTTCACAAGGATACGTCACCTTTCTCACTTTTCTCCTCATCCCTATTCTCTTGATCTTTGTCTCATGGTACACTTGCAGTACTTCCCATGAATATTCACGCTTCTGTAGACCATATATGAACACCATTAAAGATTTCATCTTTAAAGATTCATACGATTTTGCTGATTTACCTCTCGTTTCAACTAAGATATTTGATGTCGATTCTTATGGTGCTAAAGGTGATGGCAAAAAAGATGATACGAAGGCATTCCAGAA...

CDS

Download CDS FASTA

3966 bp · LXL04_018434|LXL04_018434|OH1004|CDS

ATGGCTTCACAAGGATACGTCACCTTTCTCACTTTTCTCCTCATCCCTATTCTCTTGATCTTTGTCTCATGGTACACTTGCAGTACTTCCCATGAATATTCACGCTTCTGTAGACCATATATGAACACCATTAAAGATTTCATCTTTAAAGATTCATACGATTTTGCTGATTTACCTCTCGTTTCAACTAAGATATTTGATGTCGATTCTTATGGTGCTAAAGGTGATGGCAAAAAAGATGATACGAAGGCATTCCAGAA...

Protein

Download Protein FASTA

1321 aa · LXL04_018434|LXL04_018434|OH1004|PROTEIN

MASQGYVTFLTFLLIPILLIFVSWYTCSTSHEYSRFCRPYMNTIKDFIFKDSYDFADLPLVSTKIFDVDSYGAKGDGKKDDTKAFQKAWKDACKSTTASVFSVAKNKKYLVSPIRFKGPCKSSLTMQVSGTILASKDRSKYKKDERHWLRVDGVENLLVQGGGVIDGNGDIWWSNSCKVDKTQPCKDAPTAFTLYKCTTLMVNNLTIQNGQQIQISFDNCENVRVSNLQVTAPKDSPNTDGIHVTHTHNITISNSVIGTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018434`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018434

Location Chr04:12923652-12930063 (+)

Description Similar to Polygalacturonase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57510`	Polygalacturonase involved in cell separation in the final stages of pod shatter and in anther dehiscence.	ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE1 (ADPG1), ADPG2, and QUARTET2 are Polygalacturonases required for cell separation during reproductive development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063768
`At2g41850`	Polygalacturonase involved in cell separation in the final stages of pod shatter, in anther dehiscence and in floral organ abscission.	Expression of polygalacturonases and evidence to support their role during cell separation processes in Arabidopsis thaliana.2007 · DOI: 10.1093/jxb/erm222 ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE1 (ADPG1), ADPG2, and QUARTET2 are Polygalacturonases required for cell separation during reproductive development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063768

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018434 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009830 cell wall modification involved in abscission Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004650 polygalacturonase activity Molecular Function

KEGG gene cross-reference

ath:AT2G41850

ath:AT3G57510

sly:544051

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.731

Rank 1 · LXL04_018434 · OH-1004

Cytoplasm0.243

Rank 2 · LXL04_018434 · OH-1004

Endoplasmic reticulum0.071

Rank 3 · LXL04_018434 · OH-1004

Extracellular0.066

Rank 4 · LXL04_018434 · OH-1004

Cell membrane0.062

Rank 5 · LXL04_018434 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00295.24Glyco_hydro_2893-422 aa

PF10551.16MULE753-848 aa

PF00872.25Transposase_mut770-850 aa

PF04434.23SWIM999-1029 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018434	`PF00295.24`	Glyco_hydro_28	93	422	2.4e-100	336.5
LXL04_018434	`PF10551.16`	MULE	753	848	8.7e-17	62.0
LXL04_018434	`PF00872.25`	Transposase_mut	770	850	5.6e-07	29.5
LXL04_018434	`PF04434.23`	SWIM	999	1029	4.7e-10	39.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23147`	Arabidopsis thaliana	Polygalacturonase ADPG1	57.224%	Swiss-Prot	weak database homology
`Q8RY29`	Arabidopsis thaliana	Polygalacturonase ADPG2	54.009%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card