LXL04_018404 | RubberDandelionOmics

Gene overview

LXL04_018404

Reference: OH-1004 Chr: Chr04 Coordinates: 12525229-12526230 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_018404|LXL04_018404|OH1004|cDNA

ATGAAAATGAAGACATCTTTCTTCACCATTGCTCTACTCTCCCTCACCATCTCCCTTTCTCTCCCATCCCTTTCTCTCTCCCAACGGTGCAACAAAAAAGACGAAAAAATCCTCTTCCGAATAAAAAAATCCTTCGGAAACCCTGATGTCCTGGCCACATGGACCAGAGACACCGACTGTTGTTCATGGTATTCAGTACAATGTGACGAGTACACCGACCGTATCAGTGCACTCACCATCTTCTCTGGCAACATCTCTGG...

CDS

Download CDS FASTA

1002 bp · LXL04_018404|LXL04_018404|OH1004|CDS

ATGAAAATGAAGACATCTTTCTTCACCATTGCTCTACTCTCCCTCACCATCTCCCTTTCTCTCCCATCCCTTTCTCTCTCCCAACGGTGCAACAAAAAAGACGAAAAAATCCTCTTCCGAATAAAAAAATCCTTCGGAAACCCTGATGTCCTGGCCACATGGACCAGAGACACCGACTGTTGTTCATGGTATTCAGTACAATGTGACGAGTACACCGACCGTATCAGTGCACTCACCATCTTCTCTGGCAACATCTCTGG...

Protein

Download Protein FASTA

333 aa · LXL04_018404|LXL04_018404|OH1004|PROTEIN

MKMKTSFFTIALLSLTISLSLPSLSLSQRCNKKDEKILFRIKKSFGNPDVLATWTRDTDCCSWYSVQCDEYTDRISALTIFSGNISGHITEAIGNLPYLETLILRKLTNLTGQIPSSITKLTSLKTLTISWTNLSGPIPSFLSQIKSLASLDLSYNSFTGAIPPELSTLPKLRTLRLDRNRLTGSIPESFGNFTGRVPAIYLSHNLLNGTLPQTLGQVNFTWLDLSRNRFFGDLSVFFGTNKTIKAANFSRNMFEFNFSN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018404`
TK1151 ID	TkA08G058820
OH-1004 ID	LXL04_018404
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 99.399 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018404

Location Chr04:12525229-12526230 (-)

Description Similar to PGIP: Polygalacturonase inhibitor

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06860`	Inhibitor of fungal polygalacturonase.	No verified direct reference in this release
`At5g06870`	Inhibitor of fungal polygalacturonase.	No verified direct reference in this release
`At3g12145`	Promotes flowering transition in long days (LD).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018404 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G12145

ath:AT5G06860

ath:AT5G06870

vvi:100232865

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.375

Rank 1 · LXL04_018404 · OH-1004

Extracellular0.352

Rank 2 · LXL04_018404 · OH-1004

Endoplasmic reticulum0.116

Rank 3 · LXL04_018404 · OH-1004

Cytoplasm0.072

Rank 4 · LXL04_018404 · OH-1004

Plastid0.039

Rank 5 · LXL04_018404 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_232-69 aa

PF23598.2LRR_1488-186 aa

PF13855.13LRR_8123-182 aa

PF12799.14LRR_4147-183 aa

PF13855.13LRR_8170-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018404	`PF08263.18`	LRRNT_2	32	69	2e-09	38.3
LXL04_018404	`PF23598.2`	LRR_14	88	186	8.3e-12	45.2
LXL04_018404	`PF13855.13`	LRR_8	123	182	1.1e-12	48.3
LXL04_018404	`PF12799.14`	LRR_4	147	183	1.6e-08	35.2
LXL04_018404	`PF13855.13`	LRR_8	170	230	1.1e-12	48.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M5J9`	Arabidopsis thaliana	Polygalacturonase inhibitor 1	55.556%	Swiss-Prot	strong database homology
`Q9M5J8`	Arabidopsis thaliana	Polygalacturonase inhibitor 2	52.614%	Swiss-Prot	strong database homology
`Q9LH52`	Arabidopsis thaliana	Leucine-rich repeat protein FLOR 1	47.826%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card