LXL04_018388 | RubberDandelionOmics

Gene overview

LXL04_018388

Reference: OH-1004 Chr: Chr04 Coordinates: 12387937-12389710 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

915 bp · LXL04_018388|LXL04_018388|OH1004|cDNA

ATGGCGTGTTGTTCGATTCAATCCACGGTTCCTTCAATTTCAGGTCTATCGTCTTCCTCTGTGTCGTATTCATCTGTAATTGTTTCGCCTGTAAACTATGCGAAGTTCCCCAATGGAAATCTCAAGAAAAATCGTAAGAAATTGCAAGTTTGTAGAGCAATGGTGCAGCAGACCGCGGTTCAGGGAGCTTCTGCTACCTACGCTAAGGAAATGGAGAGACTTTCTGCCAAAGAATCGTTACTCCTCGCTTTCAAAGATGC...

CDS

Download CDS FASTA

915 bp · LXL04_018388|LXL04_018388|OH1004|CDS

ATGGCGTGTTGTTCGATTCAATCCACGGTTCCTTCAATTTCAGGTCTATCGTCTTCCTCTGTGTCGTATTCATCTGTAATTGTTTCGCCTGTAAACTATGCGAAGTTCCCCAATGGAAATCTCAAGAAAAATCGTAAGAAATTGCAAGTTTGTAGAGCAATGGTGCAGCAGACCGCGGTTCAGGGAGCTTCTGCTACCTACGCTAAGGAAATGGAGAGACTTTCTGCCAAAGAATCGTTACTCCTCGCTTTCAAAGATGC...

Protein

Download Protein FASTA

304 aa · LXL04_018388|LXL04_018388|OH1004|PROTEIN

MACCSIQSTVPSISGLSSSSVSYSSVIVSPVNYAKFPNGNLKKNRKKLQVCRAMVQQTAVQGASATYAKEMERLSAKESLLLAFKDAGGFEALIGGSTSDMQKIDVNERIVSLERLNPTPRPTTSPFLEGRWNFEWIGYGSPGLFAARLLSERFPTRIANLSKMDVVIKDGYAKITANMKFLNAIENKFIITTKLTVEGPLRIKEEYTEGVLETPTIDEGTIPEQLKGFLGQAVNTMQQLPASIKDVVSSGLRVPLNGAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018388`
TK1151 ID	TkA08G058190
OH-1004 ID	LXL04_018388
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 98.485 / OH-1004 85.526 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018388

Location Chr04:12387937-12389710 (+)

Description Similar to PAP13: Probable plastid-lipid-associated protein 13, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42130`	Probable plastid-lipid-associated protein 13, chloroplastic.	No verified direct reference in this release
`At3g58010`	Probable plastid-lipid-associated protein 9, chloroplastic.	No verified direct reference in this release
`At4g04020`	Probably involved in light/cold stress-related jasmonate (JA) biosynthesis.	Plant lipid-associated fibrillin proteins condition jasmonate production under photosynthetic stress.2010 · DOI: 10.1111/j.1365-313x.2009.04067.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018388 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010117 photoprotection Biological Process

GO:0010205 photoinhibition Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G42130

ath:AT3G58010

ath:AT4G04020

csv:101203857

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.989

Rank 1 · LXL04_018388 · OH-1004

Mitochondrion0.019

Rank 2 · LXL04_018388 · OH-1004

Nucleus0.014

Rank 3 · LXL04_018388 · OH-1004

Cytoplasm0.013

Rank 4 · LXL04_018388 · OH-1004

Peroxisome0.011

Rank 5 · LXL04_018388 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04755.19PAP_fibrillin95-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018388	`PF04755.19`	PAP_fibrillin	95	282	1.2e-13	52.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S9M1`	Arabidopsis thaliana	Probable plastid-lipid-associated protein 13, chloroplastic	68.702%	Swiss-Prot	strong database homology
`Q9M2P7`	Arabidopsis thaliana	Probable plastid-lipid-associated protein 9, chloroplastic	64.659%	Swiss-Prot	strong database homology
`O81439`	Arabidopsis thaliana	Probable plastid-lipid-associated protein 1, chloroplastic	29.245%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card