LXL04_018326 | RubberDandelionOmics

Gene overview

LXL04_018326

Reference: OH-1004 Chr: Chr04 Coordinates: 11711844-11713552 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1188 bp · LXL04_018326|LXL04_018326|OH1004|cDNA

ATGGCGGACGCTAGCGGAGGCTACACTGAGTTTCCGGCGGTGCCGACTCACGGAGGTCAGTTTATCCGCTATAACATCTTCGGTAATGAATTTGAGATCACCAACAAGTATCGTCCTCCAATCATGCCTATTGGTCGTGGTGCTTATGGAATCGTCTGCTCGATGTTGAACTCCGAGACGAACGAGATGGTTGCTGTGAAGAAGATTGCAAATGCTTTCGATAATTACATGGACGCTAAGCGGACGCTTCGCGAGATCAA...

CDS

Download CDS FASTA

1188 bp · LXL04_018326|LXL04_018326|OH1004|CDS

ATGGCGGACGCTAGCGGAGGCTACACTGAGTTTCCGGCGGTGCCGACTCACGGAGGTCAGTTTATCCGCTATAACATCTTCGGTAATGAATTTGAGATCACCAACAAGTATCGTCCTCCAATCATGCCTATTGGTCGTGGTGCTTATGGAATCGTCTGCTCGATGTTGAACTCCGAGACGAACGAGATGGTTGCTGTGAAGAAGATTGCAAATGCTTTCGATAATTACATGGACGCTAAGCGGACGCTTCGCGAGATCAA...

Protein

Download Protein FASTA

395 aa · LXL04_018326|LXL04_018326|OH1004|PROTEIN

MADASGGYTEFPAVPTHGGQFIRYNIFGNEFEITNKYRPPIMPIGRGAYGIVCSMLNSETNEMVAVKKIANAFDNYMDAKRTLREIKLLRHLDHENASPSSQSYLLFVKTITPYIWLIMIQIIAIKDIIPPPLRREFSDVYITTELMDTDLHQIIRSNQNLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARTSAENDFMTEYVVTRWYRAPELLLNSSDYTVAIDVWSVGCIFMELMNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018326`
TK1151 ID	TkA08G054950
OH-1004 ID	LXL04_018326
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	86.200
Protein coverage (%)	TK1151 100.000 / OH-1004 58.734 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018326

Location Chr04:11711844-11713552 (+)

Description Similar to MPK3: Mitogen-activated protein kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45640`	Involved in oxidative stress-mediated signaling cascade (such as ozone).	MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a RNA interference-based (RNAi) suppression of AtMPK6, an Arabidopsis mitogen-activated protein kinase, results in hypersensitivity to ozone and misregulation of AtMPK3.2005 · DOI: 10.1016/j.envpol.2005.04.017 Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling.2008 · DOI: 10.1038/nature06543 A fungal-responsive MAPK cascade regulates phytoalexin biosynthesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0711301105 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x Arabidopsis MKK4 mediates osmotic-stress response via its regulation of MPK3 activity.2011 · DOI: 10.1016/j.bbrc.2011.07.064 A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Arabidopsis LIP5, a positive regulator of multivesicular body biogenesis, is a critical target of pathogen-responsive MAPK cascade in plant basal defense.2014 · DOI: 10.1371/journal.ppat.1004243 The BASL polarity protein controls a MAPK signaling feedback loop in asymmetric cell division.2015 · DOI: 10.1016/j.devcel.2015.02.022

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0154500`	Involved in sphingolipid elicitor (SE)-dependent defense signaling pathway.	A sphingolipid elicitor-inducible mitogen-activated protein kinase is regulated by the small GTPase OsRac1 and heterotrimeric G-protein in rice 1[w].2005 · DOI: 10.1104/pp.104.057414 OsDMI3-mediated activation of OsMPK1 regulates the activities of antioxidant enzymes in abscisic acid signalling in rice.2014 · DOI: 10.1111/pce.12154

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018326 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009875 pollen-pistil interaction Biological Process

KEGG gene cross-reference

ath:AT3G45640

cann:107873437

dosa:Os06g0154500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · LXL04_018326 · OH-1004

Nucleus0.569

Rank 2 · LXL04_018326 · OH-1004

Cell membrane0.066

Rank 3 · LXL04_018326 · OH-1004

Mitochondrion0.050

Rank 4 · LXL04_018326 · OH-1004

Endoplasmic reticulum0.032

Rank 5 · LXL04_018326 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase43-349 aa

PF07714.24PK_Tyr_Ser-Thr44-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018326	`PF00069.32`	Pkinase	43	349	3.8e-66	223.9
LXL04_018326	`PF07714.24`	PK_Tyr_Ser-Thr	44	260	3.6e-28	99.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39023`	Arabidopsis thaliana	Mitogen-activated protein kinase 3	76.203%	Swiss-Prot	strong database homology
`Q84UI5`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 1	72.251%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card