LXL04_018325 | RubberDandelionOmics

Gene overview

LXL04_018325

Reference: OH-1004 Chr: Chr04 Coordinates: 11649380-11652545 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1695 bp · LXL04_018325|LXL04_018325|OH1004|cDNA

ATGACACCAAAATGTGAGGCTCACAAATATCGCCACAATCCTTCAATCCTCTTTCTCTCTCAGGCCACGCGTGAAAGGAGCAGGCATGAGGCTTCTTCAAGCTCCAGCGTCTGTGTATGTGACTTCACAATGCTCAAAGCCTCAATCCAGAGGTATCCTTTTGATATCTGTGGAAGTATTCTGGAGAGGCGTATTTTGCAGTCCGCCATTAATGATTCTCTTCTCTCTCGAAGAATAGTACGACAACAAATTTCGTTAAC...

CDS

Download CDS FASTA

1695 bp · LXL04_018325|LXL04_018325|OH1004|CDS

ATGACACCAAAATGTGAGGCTCACAAATATCGCCACAATCCTTCAATCCTCTTTCTCTCTCAGGCCACGCGTGAAAGGAGCAGGCATGAGGCTTCTTCAAGCTCCAGCGTCTGTGTATGTGACTTCACAATGCTCAAAGCCTCAATCCAGAGGTATCCTTTTGATATCTGTGGAAGTATTCTGGAGAGGCGTATTTTGCAGTCCGCCATTAATGATTCTCTTCTCTCTCGAAGAATAGTACGACAACAAATTTCGTTAAC...

Protein

Download Protein FASTA

564 aa · LXL04_018325|LXL04_018325|OH1004|PROTEIN

MTPKCEAHKYRHNPSILFLSQATRERSRHEASSSSSVCVCDFTMLKASIQRYPFDICGSILERRILQSAINDSLLSRRIVRQQISLTRRTVKPVSATASSLEADASTLLTVEAENDVLKALSQIIDPDFGTDIVSCGFIKDLQVDDISGEVSFRLELTTPACPIKDLFEKQANEVVAALPWVKNVTVTMSAQPPKQIFSAQLPAGLQTISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018325`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018325

Location Chr04:11649380-11652545 (-)

Description Similar to HCF101: Fe-S cluster assembly factor HCF101, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24430`	Required for photosystem I (PSI) biosynthesis and assembly.	A novel protein for photosystem I biogenesis.2004 · DOI: 10.1074/jbc.m309246200 The universally conserved HCF101 protein is involved in assembly of [4Fe-4S]-cluster-containing complexes in Arabidopsis thaliana chloroplasts.2004 · DOI: 10.1046/j.1365-313x.2003.01952.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0719700`	Required for photosystem I (PSI) biosynthesis and assembly.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018325 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

GO:0140663 ATP-dependent FeS chaperone activity Molecular Function

KEGG gene cross-reference

ath:AT3G24430

dosa:Os01g0719700

heo:C694_01035

hpj:jhp_0193

hpy:HP_0207

syn:slr0067

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.948

Rank 1 · LXL04_018325 · OH-1004

Mitochondrion0.086

Rank 2 · LXL04_018325 · OH-1004

Cytoplasm0.048

Rank 3 · LXL04_018325 · OH-1004

Nucleus0.029

Rank 4 · LXL04_018325 · OH-1004

Peroxisome0.025

Rank 5 · LXL04_018325 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01883.25FeS_assembly_P115-187 aa

PF10609.16ParA209-445 aa

PF13614.13AAA_31211-330 aa

PF09140.18MipZ212-358 aa

PF01656.30CbiA213-358 aa

PF06155.18GBBH-like_N480-542 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018325	`PF01883.25`	FeS_assembly_P	115	187	9e-20	71.5
LXL04_018325	`PF10609.16`	ParA	209	445	3.1e-82	276.4
LXL04_018325	`PF13614.13`	AAA_31	211	330	3.2e-10	40.9
LXL04_018325	`PF09140.18`	MipZ	212	358	5.4e-07	29.9
LXL04_018325	`PF01656.30`	CbiA	213	358	6.4e-10	39.8
LXL04_018325	`PF06155.18`	GBBH-like_N	480	542	4.4e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6STH5`	Arabidopsis thaliana	Fe-S cluster assembly factor HCF101, chloroplastic	88.591%	Swiss-Prot	strong database homology
`Q0JJS8`	Oryza sativa subsp. japonica	Fe-S cluster assembly factor HCF101, chloroplastic	86.755%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card