Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1488 bp · LXL04_018237|LXL04_018237|OH1004|cDNA
ATGTTCGCTCTCCGAATTCACACACTTGATACTTCCCAACCGCCGTTCGCGACCCAATTCGGCGGCGGAGCCGCTACATCCGGTACTAAATCTGCCGTCGCCGGAGGTTCAAACCCTAAGTCTAAGAAAAACTTGTCCAGTCCTACTGAATTGAAAGGTATAGTCCACCTCTTCCGCAATCTACCAACCTTCAGCTCCTCCCCCACGATGACGTTGTTCAATGTCACTACGCGCACCACACTTGTGTTTATCGTCGCTGT...
1488 bp · LXL04_018237|LXL04_018237|OH1004|CDS
ATGTTCGCTCTCCGAATTCACACACTTGATACTTCCCAACCGCCGTTCGCGACCCAATTCGGCGGCGGAGCCGCTACATCCGGTACTAAATCTGCCGTCGCCGGAGGTTCAAACCCTAAGTCTAAGAAAAACTTGTCCAGTCCTACTGAATTGAAAGGTATAGTCCACCTCTTCCGCAATCTACCAACCTTCAGCTCCTCCCCCACGATGACGTTGTTCAATGTCACTACGCGCACCACACTTGTGTTTATCGTCGCTGT...
Protein
Download Protein FASTA495 aa · LXL04_018237|LXL04_018237|OH1004|PROTEIN
MFALRIHTLDTSQPPFATQFGGGAATSGTKSAVAGGSNPKSKKNLSSPTELKGIVHLFRNLPTFSSSPTMTLFNVTTRTTLVFIVAVPNYLSTEEFIAFCGSHVEYFSDLCFIRNDAMEDRYSVLIKLVNQAAADGFCCSYNGKRFSPSETEVCHIYFAQLVEYTDSAEIASIPQPGYTELPTCPVCLERLDHDTSAIKITVCDHSFQCSCITKWPFWSCQVCRLCQQQDGKPTCAVCGTSSNPWVCLICSFVGCGRYEK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018237 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018237 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:9218056-9220649 (-) | |||||||||
| Description | Similar to BRIZ1: BRAP2 RING ZnF UBP domain-containing protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000165 MAPK cascade Biological Process GO:0007265 Ras protein signal transduction Biological Process GO:0009968 negative regulation of signal transduction Biological Process GO:0010029 regulation of seed germination Biological Process GO:0016567 protein ubiquitination Biological Process GO:0023051 regulation of signaling Biological Process GO:0000151 ubiquitin ligase complex Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0031965 nuclear membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G26000 ath:AT2G42160 hsa:8315 mmu:72399 spo:2542333 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07576.19BRAP276-171 aaPF02148.26zf-UBP235-296 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_018237 | PF07576.19 | BRAP2 | 76 | 171 | 3.3e-32 | 111.3 |
| LXL04_018237 | PF02148.26 | zf-UBP | 235 | 296 | 3.1e-22 | 79.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.