LXL04_018193 | RubberDandelionOmics

Gene overview

LXL04_018193

Reference: OH-1004 Chr: Chr04 Coordinates: 8432882-8433292 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · LXL04_018193|LXL04_018193|OH1004|cDNA

ATGCATTCATCCATGGCTTCTTTGAGATCATCTCTTCTCATTCTTTCTTTGTTTGCAACACTGATCATGCTAGCCTTATCCCCATGTGGGCTAGCTCAAGAACTTCAACCCTCAATGTTTGAAGAGCTCCAATCATCAACACCTTCCCAATTACCAAGCTTAGGAGATTGTTGGCAATCTGTTGAAGAGATCATTGGTTGTTATTCAGAAATTTATCGGGCTTTTGTGAATGGAAAAATTGGGATGACGATTGGCCCTTC...

CDS

Download CDS FASTA

411 bp · LXL04_018193|LXL04_018193|OH1004|CDS

ATGCATTCATCCATGGCTTCTTTGAGATCATCTCTTCTCATTCTTTCTTTGTTTGCAACACTGATCATGCTAGCCTTATCCCCATGTGGGCTAGCTCAAGAACTTCAACCCTCAATGTTTGAAGAGCTCCAATCATCAACACCTTCCCAATTACCAAGCTTAGGAGATTGTTGGCAATCTGTTGAAGAGATCATTGGTTGTTATTCAGAAATTTATCGGGCTTTTGTGAATGGAAAAATTGGGATGACGATTGGCCCTTC...

Protein

Download Protein FASTA

136 aa · LXL04_018193|LXL04_018193|OH1004|PROTEIN

MHSSMASLRSSLLILSLFATLIMLALSPCGLAQELQPSMFEELQSSTPSQLPSLGDCWQSVEEIIGCYSEIYRAFVNGKIGMTIGPSCCLAIEDISSNCWPQMFPQAAASFPPLLKGYCRRYQPDAVTPSAEPDYF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018193`
TK1151 ID	TkA08G021110
OH-1004 ID	LXL04_018193
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 83.824 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018193

Location Chr04:8432882-8433292 (+)

Description Similar to EC1.4: Egg cell-secreted protein 1.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39340`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release
`At1g76750`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release
`At2g21740`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release
`At2g21750`	Involved in the regulation of gamete interactions during the double fertilization and to prevent multiple-pollen tube attraction; mediates the redistribution of the gamete fusogen HAP2/GCS1 to the cell surface after secretion upon sperm arrival.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018193 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0080155 regulation of double fertilization forming a zygote and endosperm Biological Process

GO:2000008 regulation of protein localization to cell surface Biological Process

GO:0005576 extracellular region Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

GO:0031982 vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G76750

ath:AT2G21740

ath:AT2G21750

ath:AT4G39340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.393

Rank 1 · LXL04_018193 · OH-1004

Endoplasmic reticulum0.222

Rank 2 · LXL04_018193 · OH-1004

Cytoplasm0.168

Rank 3 · LXL04_018193 · OH-1004

Lysosome / Vacuole0.151

Rank 4 · LXL04_018193 · OH-1004

Cell membrane0.114

Rank 5 · LXL04_018193 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05617.17Prolamin_like56-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018193	`PF05617.17`	Prolamin_like	56	119	4.2e-15	56.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T039`	Arabidopsis thaliana	Egg cell-secreted protein 1.4	28.455%	Swiss-Prot	weak database homology
`Q9SRD8`	Arabidopsis thaliana	Egg cell-secreted protein 1.1	31.783%	Swiss-Prot	moderate database homology
`Q9SJ24`	Arabidopsis thaliana	Egg cell-secreted protein 1.2	29.907%	Swiss-Prot	weak database homology
`Q9SJ23`	Arabidopsis thaliana	Egg cell-secreted protein 1.3	29.114%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card