LXL04_018108 | RubberDandelionOmics

Gene overview

LXL04_018108

Reference: OH-1004 Chr: Chr04 Coordinates: 6798819-6800354 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

706 bp · LXL04_018108|LXL04_018108|OH1004|cDNA

AGGTCAAAACTTTCCCAAACCCACATTTGCAAGATCACAGCCTACTTTTTCTTGATTTATTGTTTGTGCTGCTCACCAAATCACTCCCTTCTCTTCCCCCATATCTCACGCATTTCGATACCCACAAATACTTAAACTAGGGTTCTTCTCTATCCTCAATTTCAGAACAAAAACTATCATGGGGAACACATCGTCAATGCTCACTCAATACGACATCgaagaagttcaagaacattgcAACAACACCTTTTCACAACAAG...

CDS

Download CDS FASTA

528 bp · LXL04_018108|LXL04_018108|OH1004|CDS

ATGGGGAACACATCGTCAATGCTCACTCAATACGACATCGAAGAAGTTCAAGAACATTGCAACAACACCTTTTCACAACAAGAGATAGTCTCCCTATACCAAAGGTTTTGTCAGTTGGATCGTAACAGTGGCGGGTTCATCTCAGCTGACGAATTTCTTTCGGTGCCGGAATTCGCCGTTAATCCTCTCTCCCAGCGATTATTCAGGATGATTGATGGATTGAATTTCAAGGAGTTTGTTTTATTTTTATCTGCATTTAG...

Protein

Download Protein FASTA

175 aa · LXL04_018108|LXL04_018108|OH1004|PROTEIN

MGNTSSMLTQYDIEEVQEHCNNTFSQQEIVSLYQRFCQLDRNSGGFISADEFLSVPEFAVNPLSQRLFRMIDGLNFKEFVLFLSAFSSRATLQHKVEFIFKVYDSDGNGKVAFSDLLDVLRDLTGQFISEQQRELVLTHVLEEAGYKKDSLLVLSDFMKILGNNGLKMEVEIPVD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018108`
TK1151 ID	TkA08G026390
OH-1004 ID	LXL04_018108
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 74.786 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_018108`
Location	Chr04:6798819-6800354 (-)
Description	Similar to CNB1: Calcineurin subunit B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018108` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006873 intracellular monoatomic ion homeostasis Biological Process GO:0043157 response to cation stress Biological Process GO:0071444 cellular response to pheromone Biological Process GO:0097720 calcineurin-mediated signaling Biological Process GO:0005955 calcineurin complex Cellular Component GO:0004723 calcium-dependent protein serine/threonine phosphatase activity Molecular Function GO:0005509 calcium ion binding Molecular Function GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity Molecular Function GO:0019902 phosphatase binding Molecular Function GO:0019903 protein phosphatase binding Molecular Function
KEGG gene cross-reference	cnb:CNBD5950 ddi:DDB_G0267446 ncr:NCU03833 ngr:NAEGRDRAFT_35722 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · LXL04_018108 · OH-1004

Nucleus0.220

Rank 2 · LXL04_018108 · OH-1004

Cell membrane0.149

Rank 3 · LXL04_018108 · OH-1004

Golgi apparatus0.137

Rank 4 · LXL04_018108 · OH-1004

Lysosome / Vacuole0.111

Rank 5 · LXL04_018108 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00036.39EF-hand_196-122 aa

PF13499.13EF-hand_796-160 aa

PF13405.13EF-hand_697-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018108	`PF00036.39`	EF-hand_1	96	122	1.7e-09	37.3
LXL04_018108	`PF13499.13`	EF-hand_7	96	160	3.4e-09	37.6
LXL04_018108	`PF13405.13`	EF-hand_6	97	122	8.1e-10	38.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card