LXL04_018100 | RubberDandelionOmics

Gene overview

LXL04_018100

Reference: OH-1004 Chr: Chr04 Coordinates: 6650076-6654262 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3120 bp · LXL04_018100|LXL04_018100|OH1004|cDNA

ATGAGTTCTAGTGGCGGTGGCTCAGAGGGCGTTATACAAAGGGGAAAGCTTATAGTTCACATAGCCGAAAATGGCCATTCTTTTGATCTCAATTGTGACGAATATACCCTTGTTGAAGCTGTTCAAAGGTACCTGGAATCACTTTCAGGGATACCCTTAAACGACCAACTTCTTCTCTATCTGGACATGAAATTAGAACCCCAACAACCGCTTTCTGTATACAAGCTCCCTTCAGATGATCGCGAAGTGTTCTTATTCAA...

CDS

Download CDS FASTA

3120 bp · LXL04_018100|LXL04_018100|OH1004|CDS

ATGAGTTCTAGTGGCGGTGGCTCAGAGGGCGTTATACAAAGGGGAAAGCTTATAGTTCACATAGCCGAAAATGGCCATTCTTTTGATCTCAATTGTGACGAATATACCCTTGTTGAAGCTGTTCAAAGGTACCTGGAATCACTTTCAGGGATACCCTTAAACGACCAACTTCTTCTCTATCTGGACATGAAATTAGAACCCCAACAACCGCTTTCTGTATACAAGCTCCCTTCAGATGATCGCGAAGTGTTCTTATTCAA...

Protein

Download Protein FASTA

1039 aa · LXL04_018100|LXL04_018100|OH1004|PROTEIN

MSSSGGGSEGVIQRGKLIVHIAENGHSFDLNCDEYTLVEAVQRYLESLSGIPLNDQLLLYLDMKLEPQQPLSVYKLPSDDREVFLFNRAKMRTNSTPPQPVDLQPPDHIHPDPPKPSSSSHEPHPLDEASDPALKALPSYEIQFRYHYQLGDSIYRRTLSKYEACERLSREQRVQEKALEIARGNLDHIYKMILHNYSDFVKRYSHQQRAHTNLLVNFWKDLERLRNIKLVPALQSDNRKCLSDFVKEENLRKMVEDCGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018100`
TK1151 ID	TkA08G026810
OH-1004 ID	LXL04_018100
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018100

Location Chr04:6650076-6654262 (-)

Description Similar to ATG11: Autophagy-related protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30790`	Accessory protein involved in autophagy.	AUTOPHAGY-RELATED11 plays a critical role in general autophagy- and senescence-induced mitophagy in Arabidopsis.2014 · DOI: 10.1105/tpc.113.120014

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018100 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000425 pexophagy Biological Process

GO:0006914 autophagy Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015031 protein transport Biological Process

GO:0034517 ribophagy Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0061709 reticulophagy Biological Process

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005776 autophagosome Cellular Component

KEGG gene cross-reference

ath:AT4G30790

mgr:MGG_04486

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.581

Rank 1 · LXL04_018100 · OH-1004

Nucleus0.236

Rank 2 · LXL04_018100 · OH-1004

Golgi apparatus0.186

Rank 3 · LXL04_018100 · OH-1004

Cell membrane0.180

Rank 4 · LXL04_018100 · OH-1004

Lysosome / Vacuole0.117

Rank 5 · LXL04_018100 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04108.18ATG17_like157-487 aa

PF10377.15ATG11891-1025 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018100	`PF04108.18`	ATG17_like	157	487	1.1e-27	98.1
LXL04_018100	`PF10377.15`	ATG11	891	1025	1.7e-22	80.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUG7`	Arabidopsis thaliana	Autophagy-related protein 11	53.960%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card