LXL04_018062 | RubberDandelionOmics

Gene overview

LXL04_018062

Reference: OH-1004 Chr: Chr04 Coordinates: 5896308-5899432 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · LXL04_018062|LXL04_018062|OH1004|cDNA

ATGGAATCGCCGGGGCCGCGGCTGGAGACGGCGGTGACTAAAGTTGCCGTAAGGTCGTCCGTGATAGAGTCGCTCAAGGGGTGGTCGTTATCTGGGGTACAGATTCGTAAAGAGGAGCTGAGACGGAAAATTACGATGCCGGAATATTTACGGCTCTCTATCAAAGACGCCATTGCATCAAAAGATATTGATGCCGGAAAACTCCATTACGAACGCAGTACCACCGGTGATGATAAACCGGTTCAAGTTGCCCCTGAATC...

CDS

Download CDS FASTA

1458 bp · LXL04_018062|LXL04_018062|OH1004|CDS

ATGGAATCGCCGGGGCCGCGGCTGGAGACGGCGGTGACTAAAGTTGCCGTAAGGTCGTCCGTGATAGAGTCGCTCAAGGGGTGGTCGTTATCTGGGGTACAGATTCGTAAAGAGGAGCTGAGACGGAAAATTACGATGCCGGAATATTTACGGCTCTCTATCAAAGACGCCATTGCATCAAAAGATATTGATGCCGGAAAACTCCATTACGAACGCAGTACCACCGGTGATGATAAACCGGTTCAAGTTGCCCCTGAATC...

Protein

Download Protein FASTA

485 aa · LXL04_018062|LXL04_018062|OH1004|PROTEIN

MESPGPRLETAVTKVAVRSSVIESLKGWSLSGVQIRKEELRRKITMPEYLRLSIKDAIASKDIDAGKLHYERSTTGDDKPVQVAPESPLIVFINSKSGGRYGPELMARLQDLMGEEQVIDLLSVKPQEFINYGLGCLEKLASIGDMCAKETREKLRIVVAGGDGTVGWVLGCLGELHKAGRDPVPPTAVVPLGTGNDLSRSFGWGGSFPFSWKAAIKKTLDKATRAPTSRLDSWNLVISMPAGADLDNPYSLKRTEEVVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018062`
TK1151 ID	TkA08G029980
OH-1004 ID	LXL04_018062
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 98.768 / OH-1004 82.680 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018062

Location Chr04:5896308-5899432 (-)

Description Similar to DGK4: Diacylglycerol kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57690`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	A role for diacylglycerol kinase 4 in signalling crosstalk during Arabidopsis pollen tube growth.2019 · DOI: 10.1111/nph.15674 Arabidopsis DIACYLGLYCEROL KINASE4 is involved in nitric oxide-dependent pollen tube guidance and fertilization.2020 · DOI: 10.1242/dev.183715
`At4g30340`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	Arabidopsis AtDGK7, the smallest member of plant diacylglycerol kinases (DGKs), displays unique biochemical features and saturates at low substrate concentration: the DGK inhibitor R59022 differentially affects AtDGK2 and AtDGK7 activity in vitro and alters plant growth and development.2005 · DOI: 10.1074/jbc.m506859200
`At2g18730`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	No verified direct reference in this release
`At2g20900`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0634700`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	Overexpression of a rice diacylglycerol kinase gene OsBIDK1 enhances disease resistance in transgenic tobacco.2008 · PMID: 18679055 Diacylglycerol kinase and associated lipid mediators modulate rice root architecture.2019 · DOI: 10.1111/nph.15801

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018062 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046486 glycerolipid metabolic process Biological Process

GO:0048364 root development Biological Process

GO:0048366 leaf development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004143 ATP-dependent diacylglycerol kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G18730

ath:AT2G20900

ath:AT4G30340

ath:AT5G57690

dosa:Os04g0634700

osa:4337126

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.320

Rank 1 · LXL04_018062 · OH-1004

Endoplasmic reticulum0.299

Rank 2 · LXL04_018062 · OH-1004

Cell membrane0.269

Rank 3 · LXL04_018062 · OH-1004

Mitochondrion0.209

Rank 4 · LXL04_018062 · OH-1004

Golgi apparatus0.144

Rank 5 · LXL04_018062 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00781.30DAGK_cat89-222 aa

PF00609.25DAGK_acc280-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018062	`PF00781.30`	DAGK_cat	89	222	5.5e-22	78.4
LXL04_018062	`PF00609.25`	DAGK_acc	280	457	9.6e-42	143.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PDI2`	Arabidopsis thaliana	Diacylglycerol kinase 4	64.770%	Swiss-Prot	strong database homology
`F4JQ95`	Arabidopsis thaliana	Diacylglycerol kinase 7	64.847%	Swiss-Prot	strong database homology
`Q8VZG1`	Arabidopsis thaliana	Diacylglycerol kinase 3	61.507%	Swiss-Prot	strong database homology
`Q9C5E5`	Arabidopsis thaliana	Diacylglycerol kinase 5	37.887%	Swiss-Prot	moderate database homology
`Q7XQT2`	Oryza sativa subsp. japonica	Diacylglycerol kinase 1	36.585%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card