LXL04_018025 | RubberDandelionOmics

Gene overview

LXL04_018025

Reference: OH-1004 Chr: Chr04 Coordinates: 5276347-5277900 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · LXL04_018025|LXL04_018025|OH1004|cDNA

ATGAAGGAGCTTTGGACGACGATGGCGACTCTAATGGGCGTTTGGGCTTTCTCCCAAACTCTCTTCCTCGCCGTGTTCCCGCCGGAGCTCCGGTTTGCCTTCATTCAACTCTTGCAACGGTTAGTCAACTGTTTTTCTTCCTACTGCTACTACGATATCACTGAGATCGAAGGTGTAAACACCAATGAGCTGTATAACGCCGTCCAGCTCTATCTCTCCTACTCCGCTTCATCTTCATGTTCTGCCACCTCCTCCAACCG...

CDS

Download CDS FASTA

1554 bp · LXL04_018025|LXL04_018025|OH1004|CDS

ATGAAGGAGCTTTGGACGACGATGGCGACTCTAATGGGCGTTTGGGCTTTCTCCCAAACTCTCTTCCTCGCCGTGTTCCCGCCGGAGCTCCGGTTTGCCTTCATTCAACTCTTGCAACGGTTAGTCAACTGTTTTTCTTCCTACTGCTACTACGATATCACTGAGATCGAAGGTGTAAACACCAATGAGCTGTATAACGCCGTCCAGCTCTATCTCTCCTACTCCGCTTCATCTTCATGTTCTGCCACCTCCTCCAACCG...

Protein

Download Protein FASTA

517 aa · LXL04_018025|LXL04_018025|OH1004|PROTEIN

MKELWTTMATLMGVWAFSQTLFLAVFPPELRFAFIQLLQRLVNCFSSYCYYDITEIEGVNTNELYNAVQLYLSYSASSSCSATSSNRLSITRGLNSSAITFGLSHNDRLTDVFNGVSVVWEHIVTPRQSQTFSWRPLPEEKRGFKLRINKRDKPYILKSYLDFITGKANEIRRKNEDRLLYTNSRGGSLDSRGQPWESVPFKHPSTFDTLAMDPVKKLEIMSDLRDFADGQAFYTRTGRAWKRGYLLYGPPGTGKSSMIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018025`
TK1151 ID	TkA08G032780
OH-1004 ID	LXL04_018025
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.300
Protein coverage (%)	TK1151 100.000 / OH-1004 97.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018025

Location Chr04:5276347-5277900 (-)

Description Similar to At5g57480: AAA-ATPase At5g57480

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57480`	AAA-ATPase At5g57480.	No verified direct reference in this release
`At4g25835`	AAA-ATPase At4g25835.	No verified direct reference in this release
`At4g30250`	AAA-ATPase At4g30250.	No verified direct reference in this release
`At5g40010`	Required to regulate morphology and anatomy during seed maturation.	No verified direct reference in this release
`At3g28580`	AAA-ATPase At3g28580.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018025 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0006950 response to stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010154 fruit development Biological Process

GO:0010431 seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G28580

ath:AT4G25835

ath:AT4G30250

ath:AT5G40010

ath:AT5G57480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.299

Rank 1 · LXL04_018025 · OH-1004

Nucleus0.214

Rank 2 · LXL04_018025 · OH-1004

Cytoplasm0.168

Rank 3 · LXL04_018025 · OH-1004

Plastid0.121

Rank 4 · LXL04_018025 · OH-1004

Peroxisome0.104

Rank 5 · LXL04_018025 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14363.12AAA_assoc26-123 aa

PF00004.36AAA245-397 aa

PF25568.1AAA_lid_At3g28540399-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018025	`PF14363.12`	AAA_assoc	26	123	1.3e-21	77.6
LXL04_018025	`PF00004.36`	AAA	245	397	4.2e-18	66.8
LXL04_018025	`PF25568.1`	AAA_lid_At3g28540	399	470	6.7e-11	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKM3`	Arabidopsis thaliana	AAA-ATPase At5g57480	70.319%	Swiss-Prot	strong database homology
`Q8RY66`	Arabidopsis thaliana	AAA-ATPase At4g25835	69.153%	Swiss-Prot	strong database homology
`F4JPK8`	Arabidopsis thaliana	AAA-ATPase At4g30250	66.457%	Swiss-Prot	strong database homology
`Q9FLD5`	Arabidopsis thaliana	AAA-ATPase ASD, mitochondrial	42.035%	Swiss-Prot	moderate database homology
`Q9LJJ7`	Arabidopsis thaliana	AAA-ATPase At3g28580	43.709%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card