LXL04_018011 | RubberDandelionOmics

Gene overview

LXL04_018011

Reference: OH-1004 Chr: Chr04 Coordinates: 5075142-5076036 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · LXL04_018011|LXL04_018011|OH1004|cDNA

ATGGCATCAGCATCCATACCCTCTGGTGCCCTGGTTCTTTTACAAGAACTCGACTCCTCTTCATCACACTTCAAGCAAGGAGCATCCATCAGGGTTACTGGAAAGTTACAAGAATATAGTGTAGAGACAGCCATCGCCATTGTTGCTGATGGAGGTGCTACCCTAGCAGTTGACACCCAGCATTTAAGACTTAATCTTCGAGTGGGATCCCTTTACCAGTTTATTGGAGAACTTTCCATTCAACCAAATAATGAGGGGAT...

CDS

Download CDS FASTA

381 bp · LXL04_018011|LXL04_018011|OH1004|CDS

ATGGCATCAGCATCCATACCCTCTGGTGCCCTGGTTCTTTTACAAGAACTCGACTCCTCTTCATCACACTTCAAGCAAGGAGCATCCATCAGGGTTACTGGAAAGTTACAAGAATATAGTGTAGAGACAGCCATCGCCATTGTTGCTGATGGAGGTGCTACCCTAGCAGTTGACACCCAGCATTTAAGACTTAATCTTCGAGTGGGATCCCTTTACCAGTTTATTGGAGAACTTTCCATTCAACCAAATAATGAGGGGAT...

Protein

Download Protein FASTA

126 aa · LXL04_018011|LXL04_018011|OH1004|PROTEIN

MASASIPSGALVLLQELDSSSSHFKQGASIRVTGKLQEYSVETAIAIVADGGATLAVDTQHLRLNLRVGSLYQFIGELSIQPNNEGILKARVGRNVDGMDLNLYQQSLKLLRQFQSDQISHLENLQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018011`
TK1151 ID	TkA08G033640
OH-1004 ID	LXL04_018011
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018011

Location Chr04:5075142-5076036 (-)

Description Similar to TEN1: CST complex subunit TEN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56260`	Required for the maintenance of meristems and stem cells through the reduction of DNA damage.	The Arabidopsis MERISTEM DISORGANIZATION 1 gene is required for the maintenance of stem cells through the reduction of DNA damage.2011 · DOI: 10.1111/j.1365-313x.2011.04718.x MERISTEM DISORGANIZATION1 encodes TEN1, an essential telomere protein that modulates telomerase processivity in Arabidopsis.2013 · DOI: 10.1105/tpc.112.107425 POT1a and components of CST engage telomerase and regulate its activity in Arabidopsis.2014 · DOI: 10.1371/journal.pgen.1004738

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018011 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0009408 response to heat Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process

GO:0048367 shoot system development Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:1990879 CST complex Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0010521 telomerase inhibitor activity Molecular Function

GO:0042162 telomeric DNA binding Molecular Function

GO:0044183 protein folding chaperone Molecular Function

KEGG gene cross-reference

ath:AT1G56260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.852

Rank 1 · LXL04_018011 · OH-1004

Cytoplasm0.241

Rank 2 · LXL04_018011 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_018011 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_018011 · OH-1004

Plastid0.017

Rank 5 · LXL04_018011 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15490.13Ten1_26-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018011	`PF15490.13`	Ten1_2	6	116	8.1e-34	116.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NME7`	Arabidopsis thaliana	CST complex subunit TEN1	55.833%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card