LXL04_017958 | RubberDandelionOmics

Gene overview

LXL04_017958

Reference: OH-1004 Chr: Chr04 Coordinates: 4291862-4293802 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1440 bp · LXL04_017958|LXL04_017958|OH1004|cDNA

ATGGCTTCCACCATACCCTCAGGCAATGGCACCGTCGCGGTAGCATTAAAATCGGAGACAGAATCTGCGACTACTGCCATCGCCGTCTCAGAAGCGGCTCTTGGCACCGAGATGGAGCCGCCGGGTAAAAATCCCCTGGCTACCGATTCCGCTCTATCGGAGGAGAAGAAGTGGCCTGGATGGCCTGGGGACTGCGTTTTCCGACTCATTGTGCCGGTGCTTAAAGTCGGGAGTATAATTGGCCGGAAAGGAGATATAAT...

CDS

Download CDS FASTA

1440 bp · LXL04_017958|LXL04_017958|OH1004|CDS

ATGGCTTCCACCATACCCTCAGGCAATGGCACCGTCGCGGTAGCATTAAAATCGGAGACAGAATCTGCGACTACTGCCATCGCCGTCTCAGAAGCGGCTCTTGGCACCGAGATGGAGCCGCCGGGTAAAAATCCCCTGGCTACCGATTCCGCTCTATCGGAGGAGAAGAAGTGGCCTGGATGGCCTGGGGACTGCGTTTTCCGACTCATTGTGCCGGTGCTTAAAGTCGGGAGTATAATTGGCCGGAAAGGAGATATAAT...

Protein

Download Protein FASTA

479 aa · LXL04_017958|LXL04_017958|OH1004|PROTEIN

MASTIPSGNGTVAVALKSETESATTAIAVSEAALGTEMEPPGKNPLATDSALSEEKKWPGWPGDCVFRLIVPVLKVGSIIGRKGDIIRKMCEDTKARIRVLDAPVGTPDRIVLISGKEETDAPLSPAMDAVIRVFKRINGFPENEGESIASVPFCSIRLLVPSMQAISLIGKQGSTIKSVQESTGCQVRVLSGDDVAAISANSEERIVDMQGEAIKVLKALEAVVGHLRRFLVDRSVLPLFEKTNNVSTPTQEPQVETWA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017958`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017958

Location Chr04:4291862-4293802 (+)

Description Similar to PEP: RNA-binding KH domain-containing protein PEPPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26000`	Regulates vegetative and gynoecium development.	No verified direct reference in this release
`At3g04610`	Positively regulates flowering by repressing FLC expression and post-transcriptional modification.	No verified direct reference in this release
`At4g18375`	KH domain-containing protein At4g18375.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017958 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006396 RNA processing Biological Process

GO:0009299 mRNA transcription Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0048367 shoot system development Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048577 negative regulation of short-day photoperiodism, flowering Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G04610

ath:AT4G18375

ath:AT4G26000

mmu:59093

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.889

Rank 1 · LXL04_017958 · OH-1004

Cytoplasm0.219

Rank 2 · LXL04_017958 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_017958 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_017958 · OH-1004

Lysosome / Vacuole0.013

Rank 5 · LXL04_017958 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00013.36KH_167-119 aa

PF00013.36KH_1157-224 aa

PF00013.36KH_1337-400 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017958	`PF00013.36`	KH_1	67	119	2.3e-39	133.7
LXL04_017958	`PF00013.36`	KH_1	157	224	2.3e-39	133.7
LXL04_017958	`PF00013.36`	KH_1	337	400	2.3e-39	133.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZH4`	Arabidopsis thaliana	RNA-binding KH domain-containing protein PEPPER	49.398%	Swiss-Prot	moderate database homology
`Q9SR13`	Arabidopsis thaliana	Flowering locus K homology domain	45.330%	Swiss-Prot	moderate database homology
`P58223`	Arabidopsis thaliana	KH domain-containing protein At4g18375	27.371%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card