LXL04_017935 | RubberDandelionOmics

Gene overview

LXL04_017935

Reference: OH-1004 Chr: Chr04 Coordinates: 3946666-3947985 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · LXL04_017935|LXL04_017935|OH1004|cDNA

ATGCTGGAAGATCCGAAATATACAGGTATAATGGGCATAAATAACGGAAACAACACCGACAACTTCGTCAACCTATCCCAAGTCTTCTACCACAAACTCGGGGAAGGCTCCAACATGTCTATCGACAGCTTCAATAGTCTCCAAATGAGCAACACAGGCGGATCAATCGCCATGTCACTCGACAACAGTAGTGTCGGGTCAAACAACGACTCGCACACGCGCATCCTAAACCACCAAGGCCTAAAGCGCGTCAAAAACAA...

CDS

Download CDS FASTA

1251 bp · LXL04_017935|LXL04_017935|OH1004|CDS

ATGCTGGAAGATCCGAAATATACAGGTATAATGGGCATAAATAACGGAAACAACACCGACAACTTCGTCAACCTATCCCAAGTCTTCTACCACAAACTCGGGGAAGGCTCCAACATGTCTATCGACAGCTTCAATAGTCTCCAAATGAGCAACACAGGCGGATCAATCGCCATGTCACTCGACAACAGTAGTGTCGGGTCAAACAACGACTCGCACACGCGCATCCTAAACCACCAAGGCCTAAAGCGCGTCAAAAACAA...

Protein

Download Protein FASTA

416 aa · LXL04_017935|LXL04_017935|OH1004|PROTEIN

MLEDPKYTGIMGINNGNNTDNFVNLSQVFYHKLGEGSNMSIDSFNSLQMSNTGGSIAMSLDNSSVGSNNDSHTRILNHQGLKRVKNNYTDALSVNRGRVHQGLSDDALARALLDTRFPTQGLENFDEWTIDLRKLSMGPAFAQGAFGKLYKGTYNGEDVAIKLLEKPENDLERGQLMEQQFQQEVMMLARLKHPNIVRFIGGCKKPMVWCIVTEYAKGGSVRQFLAKRQNRSVPLKLAVKQALDVARGMEYVHGFGLIHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017935`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017935

Location Chr04:3946666-3947985 (-)

Description Similar to STY13: Serine/threonine-protein kinase STY13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24360`	Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.	Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
`At1g62400`	Serine/threonine/tyrosine kinase involved in the control of stomatal movement in response to CO(2).	No verified direct reference in this release
`At4g38470`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At2g17700`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017935 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:2000030 regulation of response to red or far red light Biological Process

KEGG gene cross-reference

ath:AT1G62400

ath:AT2G17700

ath:AT2G24360

ath:AT4G35780

ath:AT4G38470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · LXL04_017935 · OH-1004

Cell membrane0.421

Rank 2 · LXL04_017935 · OH-1004

Nucleus0.256

Rank 3 · LXL04_017935 · OH-1004

Golgi apparatus0.066

Rank 4 · LXL04_017935 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_017935 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr140-389 aa

PF00069.32Pkinase143-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017935	`PF07714.24`	PK_Tyr_Ser-Thr	140	389	2.9e-66	224.1
LXL04_017935	`PF00069.32`	Pkinase	143	387	1.6e-54	185.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ31`	Arabidopsis thaliana	Serine/threonine-protein kinase STY13	77.411%	Swiss-Prot	strong database homology
`Q2MHE4`	Arabidopsis thaliana	Serine/threonine/tyrosine-protein kinase HT1	52.075%	Swiss-Prot	moderate database homology
`F4JTP5`	Arabidopsis thaliana	Serine/threonine-protein kinase STY46	49.813%	Swiss-Prot	moderate database homology
`Q8RWL6`	Arabidopsis thaliana	Serine/threonine-protein kinase STY17	46.520%	Swiss-Prot	moderate database homology
`O22558`	Arabidopsis thaliana	Serine/threonine-protein kinase STY8	44.718%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card