LXL04_017909 | RubberDandelionOmics

Gene overview

LXL04_017909

Reference: OH-1004 Chr: Chr04 Coordinates: 3466365-3467142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · LXL04_017909|LXL04_017909|OH1004|cDNA

ATGAAGACGATCTGGGAGAAAGGAGACGATGATGATGTATGTGGTGGTAGTTGCCGGACGTCGGGAGTTGTCGGAGGAGGAGAAAATGGAGGAATGTTAGAGGTGGTAGGAGGAACGAAGTCGATGAGCATCGCAGGAGATGAGGAATGTAATTCATCGAGTAGTTCATCGATCGGAAACGACAGCGATGACGATCGGGAAGAAGATGTTGAGAGTCGTTATAATGATCATCATAACAACAATGGATCCTTCGATAATGC...

CDS

Download CDS FASTA

576 bp · LXL04_017909|LXL04_017909|OH1004|CDS

ATGAAGACGATCTGGGAGAAAGGAGACGATGATGATGTATGTGGTGGTAGTTGCCGGACGTCGGGAGTTGTCGGAGGAGGAGAAAATGGAGGAATGTTAGAGGTGGTAGGAGGAACGAAGTCGATGAGCATCGCAGGAGATGAGGAATGTAATTCATCGAGTAGTTCATCGATCGGAAACGACAGCGATGACGATCGGGAAGAAGATGTTGAGAGTCGTTATAATGATCATCATAACAACAATGGATCCTTCGATAATGC...

Protein

Download Protein FASTA

191 aa · LXL04_017909|LXL04_017909|OH1004|PROTEIN

MKTIWEKGDDDDVCGGSCRTSGVVGGGENGGMLEVVGGTKSMSIAGDEECNSSSSSSIGNDSDDDREEDVESRYNDHHNNNGSFDNAIQALEEALPIRRGISSFYNGKSKSFTSLTDVWPSTSSSIQDIAKPENAYTRKRKNLGAFKLSNINTGRISKKPRPTTFQQSQVNRRSFSMVNLHQCNPTKIENC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017909`
TK1151 ID	TkA08G040960
OH-1004 ID	LXL04_017909
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.333 / OH-1004 78.010 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017909

Location Chr04:3466365-3467142 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43850`	Protein OXIDATIVE STRESS 3 LIKE 2.	No verified direct reference in this release
`At5g21940`	Promotes slightly the tolerance to zinc (Zn) and to oxidizing chemicals (e.g. diamide).	No verified direct reference in this release
`At2g24550`	Probable transcription factor (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017909 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016301 kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G24550

ath:AT3G43850

ath:AT5G21940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.723

Rank 1 · LXL04_017909 · OH-1004

Cytoplasm0.290

Rank 2 · LXL04_017909 · OH-1004

Cell membrane0.066

Rank 3 · LXL04_017909 · OH-1004

Endoplasmic reticulum0.039

Rank 4 · LXL04_017909 · OH-1004

Plastid0.037

Rank 5 · LXL04_017909 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30470.1OXS339-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017909	`PF30470.1`	OXS3	39	159	1.3e-32	113.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1I9LQ12`	Arabidopsis thaliana	Protein OXIDATIVE STRESS 3 LIKE 2	45.614%	Swiss-Prot	moderate database homology
`Q9C593`	Arabidopsis thaliana	Protein OXIDATIVE STRESS 3 LIKE 1	44.231%	Swiss-Prot	moderate database homology
`Q945P6`	Arabidopsis thaliana	Protein OXIDATIVE STRESS 3 LIKE 6	40.299%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card