LXL04_017875 | RubberDandelionOmics

Gene overview

LXL04_017875

Reference: OH-1004 Chr: Chr04 Coordinates: 2668825-2670369 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1545 bp · LXL04_017875|LXL04_017875|OH1004|cDNA

ATGGAAGCTGAGCTCATGATCGTCTTTATGGTGGTAGCCACCGCTTCAGCCTACCTCGTATGGTTCCACCACCTCTCCCGTCGTCTTTCTGGCCCCAAAGTCTATCCTTTCTTCGGCAGCATTCCTGTTCTCTTCCTTAATAGGTCTCGCATCCATGACTGGATAGCTGGAAACCTAAGATCTTCCGGCAGTGGTGGGACTTATCAGACCACCACCATCGCCATACCCTTCTTCGCACGTAAACAAGGGTTTTACACTGT...

CDS

Download CDS FASTA

1545 bp · LXL04_017875|LXL04_017875|OH1004|CDS

ATGGAAGCTGAGCTCATGATCGTCTTTATGGTGGTAGCCACCGCTTCAGCCTACCTCGTATGGTTCCACCACCTCTCCCGTCGTCTTTCTGGCCCCAAAGTCTATCCTTTCTTCGGCAGCATTCCTGTTCTCTTCCTTAATAGGTCTCGCATCCATGACTGGATAGCTGGAAACCTAAGATCTTCCGGCAGTGGTGGGACTTATCAGACCACCACCATCGCCATACCCTTCTTCGCACGTAAACAAGGGTTTTACACTGT...

Protein

Download Protein FASTA

514 aa · LXL04_017875|LXL04_017875|OH1004|PROTEIN

MEAELMIVFMVVATASAYLVWFHHLSRRLSGPKVYPFFGSIPVLFLNRSRIHDWIAGNLRSSGSGGTYQTTTIAIPFFARKQGFYTVTCNPKNIEHILRTRFDNYPKGPTWQTAFHDLLGQGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVSRTIKTRLWLILEKASEEHFPVDLQDLLLRLTFDNICGLTFGKDPETLSLELSENPFATAFDSATEATLQRLLYPGFLWRLKKLFGIGAEMRLRKSLQVVENYMT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017875`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017875

Location Chr04:2668825-2670369 (+)

Description Similar to CYP86A1: Cytochrome P450 86A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58860`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335 CYP86A1 from Arabidopsis thaliana encodes a cytochrome P450-dependent fatty acid omega-hydroxylase.1998 · DOI: 10.1006/bbrc.1998.8156
`At4g00360`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Arabidopsis CYP86A2 represses Pseudomonas syringae type III genes and is required for cuticle development.2004 · DOI: 10.1038/sj.emboj.7600290 Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335
`At2g45970`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Functional analysis of the LACERATA gene of Arabidopsis provides evidence for different roles of fatty acid omega -hydroxylation in development.2001 · DOI: 10.1073/pnas.171285998 Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335
`At1g63710`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017875 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0010214 seed coat development Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0035336 long-chain fatty-acyl-CoA metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Molecular Function

KEGG gene cross-reference

ag:AAZ39642

ath:AT1G63710

ath:AT2G45970

ath:AT4G00360

ath:AT5G58860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.902

Rank 1 · LXL04_017875 · OH-1004

Cytoplasm0.048

Rank 2 · LXL04_017875 · OH-1004

Cell membrane0.045

Rank 3 · LXL04_017875 · OH-1004

Golgi apparatus0.037

Rank 4 · LXL04_017875 · OH-1004

Plastid0.035

Rank 5 · LXL04_017875 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45086-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017875	`PF00067.28`	p450	86	499	1.4e-63	216.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P48422`	Arabidopsis thaliana	Cytochrome P450 86A1	77.912%	Swiss-Prot	strong database homology
`O23066`	Arabidopsis thaliana	Cytochrome P450 86A2	63.743%	Swiss-Prot	strong database homology
`O80823`	Arabidopsis thaliana	Cytochrome P450 86A8	63.462%	Swiss-Prot	strong database homology
`Q9CAD6`	Arabidopsis thaliana	Cytochrome P450 86A7	63.301%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card