LXL04_017839 | RubberDandelionOmics

Gene overview

LXL04_017839

Reference: OH-1004 Chr: Chr04 Coordinates: 2170864-2172173 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · LXL04_017839|LXL04_017839|OH1004|cDNA

ATGGCTACCTCCTTCCATTTCCTCAAGTCAAACTCGGTTCTTCTGTTCATCTCGTTTCTCTCTTTACACCTTTCCCTGACCTCCGGCCATGGCGGCGAGAGTCACGTTGATGATGAGGGTATCGATTTGCGTGCGAAAGGGTTGGTGTTGGTGAAATTTTATTGCCTGATCATTATGTTCGTCACCACCTTCGCCGGCGGGGTGTCGCCGTACTTCTACAGATGGAACGAGAGCTTTCTATTATTGGGCACTCAATTCGC...

CDS

Download CDS FASTA

1002 bp · LXL04_017839|LXL04_017839|OH1004|CDS

ATGGCTACCTCCTTCCATTTCCTCAAGTCAAACTCGGTTCTTCTGTTCATCTCGTTTCTCTCTTTACACCTTTCCCTGACCTCCGGCCATGGCGGCGAGAGTCACGTTGATGATGAGGGTATCGATTTGCGTGCGAAAGGGTTGGTGTTGGTGAAATTTTATTGCCTGATCATTATGTTCGTCACCACCTTCGCCGGCGGGGTGTCGCCGTACTTCTACAGATGGAACGAGAGCTTTCTATTATTGGGCACTCAATTCGC...

Protein

Download Protein FASTA

333 aa · LXL04_017839|LXL04_017839|OH1004|PROTEIN

MATSFHFLKSNSVLLFISFLSLHLSLTSGHGGESHVDDEGIDLRAKGLVLVKFYCLIIMFVTTFAGGVSPYFYRWNESFLLLGTQFAGGVFLGTSLMHFLSDSNETFEDLTPKTYPFAFMLAASGYLLTMFGDCVILYVVKRGGGGGRENKVAEAAEEGGEPSEHGTHSHPMFAKTSSLSDTILLILALCFHSIFEGIAVGVSATKEDAWRNLWTISLHKIFAAVAMGIALLRLIPKRPFLLTVIYSFAFAISSPIGVGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017839`
TK1151 ID	TkA08G046270
OH-1004 ID	LXL04_017839
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017839

Location Chr04:2170864-2172173 (-)

Description Similar to ZIP1: Zinc transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59520`	Mediates zinc uptake.	Identification of a family of zinc transporter genes from Arabidopsis that respond to zinc deficiency.1998 · DOI: 10.1073/pnas.95.12.7220
`At1g55910`	Probably mediates zinc uptake from the rhizosphere.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0972200`	Zinc transporter that may mediate zinc uptake from the rhizosphere.	No verified direct reference in this release
`Os03g0411800`	Zinc transporter that may be involved in zinc uptake from the rhizosphere.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017839 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006829 zinc ion transport Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005385 zinc ion transmembrane transporter activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G55910

ath:AT5G59520

dosa:Os01g0972200

dosa:Os03g0411800

dre:321324

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.722

Rank 1 · LXL04_017839 · OH-1004

Endoplasmic reticulum0.116

Rank 2 · LXL04_017839 · OH-1004

Cytoplasm0.109

Rank 3 · LXL04_017839 · OH-1004

Lysosome / Vacuole0.089

Rank 4 · LXL04_017839 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_017839 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02535.29Zip50-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017839	`PF02535.29`	Zip	50	329	5.2e-55	187.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTH9`	Arabidopsis thaliana	Zinc transporter 2	59.155%	Swiss-Prot	strong database homology
`Q94EG9`	Arabidopsis thaliana	Zinc transporter 11	55.763%	Swiss-Prot	strong database homology
`Q94DG6`	Oryza sativa subsp. japonica	Zinc transporter 1	62.462%	Swiss-Prot	strong database homology
`Q852F6`	Oryza sativa subsp. japonica	Zinc transporter 2	61.039%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card