LXL04_017792 | RubberDandelionOmics

Gene overview

LXL04_017792

Reference: OH-1004 Chr: Chr04 Coordinates: 1317278-1319334 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

972 bp · LXL04_017792|LXL04_017792|OH1004|cDNA

ATGGAAAATTTCGGGCGTCGGAGAAAGCGTAGGGATCCATGGAGGTTAATTGGTCGGAGCACGGTGTCCTTCGTCTGTGTTTGCTTGGCGCAGTTTGTCCTCTACCTGATATCTTCCTTCTGTCCCTCTTCCAATATTATTTTACCTTTAGTTCTCTCAGTGATGGCATTGGTAGGGATGGCTGCAATAGGGAGAAAATTCAAGAGGTTATTTGGACTGCGTGGCTCAGCTCCTGCCTTCGTGTTTGCGAATTTATTGTT...

CDS

Download CDS FASTA

972 bp · LXL04_017792|LXL04_017792|OH1004|CDS

ATGGAAAATTTCGGGCGTCGGAGAAAGCGTAGGGATCCATGGAGGTTAATTGGTCGGAGCACGGTGTCCTTCGTCTGTGTTTGCTTGGCGCAGTTTGTCCTCTACCTGATATCTTCCTTCTGTCCCTCTTCCAATATTATTTTACCTTTAGTTCTCTCAGTGATGGCATTGGTAGGGATGGCTGCAATAGGGAGAAAATTCAAGAGGTTATTTGGACTGCGTGGCTCAGCTCCTGCCTTCGTGTTTGCGAATTTATTGTT...

Protein

Download Protein FASTA

323 aa · LXL04_017792|LXL04_017792|OH1004|PROTEIN

MENFGRRRKRRDPWRLIGRSTVSFVCVCLAQFVLYLISSFCPSSNIILPLVLSVMALVGMAAIGRKFKRLFGLRGSAPAFVFANLLFIWCAYAIVIRQAVSSLLDIVFNIELIMLQIGLYRSVILSGDPGFVNYKPPHENPDSLSNNETHPEESERLVSDQECPSDESPLLLQRVRYCKHCDAHVKGFDHHCPAFGNCIGQNNHLLFSILIAGFITAEACYILGASQILTSSKGKKVDWNEKLASSTMIFSILQVLWQGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017792`
TK1151 ID	TkA08G050560
OH-1004 ID	LXL04_017792
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017792

Location Chr04:1317278-1319334 (+)

Description Similar to Hip14: Palmitoyltransferase Hip14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09320`	Palmitoyl acyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017792 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0018230 peptidyl-L-cysteine S-palmitoylation Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:0042953 lipoprotein transport Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0050714 positive regulation of protein secretion Biological Process

GO:0051386 regulation of neurotrophin TRK receptor signaling pathway Biological Process

GO:0070372 regulation of ERK1 and ERK2 cascade Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT3G09320

dme:Dmel_CG6017

dre:100332332

mmu:320150

rno:366889

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.315

Rank 1 · LXL04_017792 · OH-1004

Golgi apparatus0.306

Rank 2 · LXL04_017792 · OH-1004

Cytoplasm0.202

Rank 3 · LXL04_017792 · OH-1004

Cell membrane0.171

Rank 4 · LXL04_017792 · OH-1004

Lysosome / Vacuole0.166

Rank 5 · LXL04_017792 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01529.26DHHC173-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017792	`PF01529.26`	DHHC	173	281	5.1e-19	69.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VV0`	Arabidopsis thaliana	Probable protein S-acyltransferase 16	26.733%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card