LXL04_017763 | RubberDandelionOmics

Gene overview

LXL04_017763

Reference: OH-1004 Chr: Chr04 Coordinates: 894019-896717 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1164 bp · LXL04_017763|LXL04_017763|OH1004|cDNA

ATGGTGTGGAGTTTGGGACTGCAAAAAATCGGAGTAACAGAGCCGCCAATCAAGAGAAAGAAGATGGTCCTCGTTACTACTTCTGCAGTTACACCGGAGTATAACCGGAAAGTTGAGCTCACGGCGTTTGATGAAACCAAAACCGGCGTCAAAGGACTTGTAGATGCCGGAATAACGGAGGTCCCTCGGATATTCCGCCTACCTGAACCTGAAAACCTAGACTCCGACCAATCAGAGCTTACTCTTCCGACCATCGATCT...

CDS

Download CDS FASTA

1164 bp · LXL04_017763|LXL04_017763|OH1004|CDS

ATGGTGTGGAGTTTGGGACTGCAAAAAATCGGAGTAACAGAGCCGCCAATCAAGAGAAAGAAGATGGTCCTCGTTACTACTTCTGCAGTTACACCGGAGTATAACCGGAAAGTTGAGCTCACGGCGTTTGATGAAACCAAAACCGGCGTCAAAGGACTTGTAGATGCCGGAATAACGGAGGTCCCTCGGATATTCCGCCTACCTGAACCTGAAAACCTAGACTCCGACCAATCAGAGCTTACTCTTCCGACCATCGATCT...

Protein

Download Protein FASTA

387 aa · LXL04_017763|LXL04_017763|OH1004|PROTEIN

MVWSLGLQKIGVTEPPIKRKKMVLVTTSAVTPEYNRKVELTAFDETKTGVKGLVDAGITEVPRIFRLPEPENLDSDQSELTLPTIDLDGIDKDPIRRKEVIGKVKDALESWGFFQMVNHGIPISVMEEMKKGVIGFHEQDSEVKKEWYTRDRRRLVYNSNFDLFSAPVTNWRDTFLCNMAPNPPQLHELPPPCSDILLEYSRQMMKLGSCILMLISEALGLDPNHLLNMGFGDGLSILGHYYPSCPQPELTIGASEHADN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017763`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017763

Location Chr04:894019-896717 (+)

Description Similar to At1g06620: 1-aminocyclopropane-1-carboxylate oxidase homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06620`	1-aminocyclopropane-1-carboxylate oxidase homolog 1.	No verified direct reference in this release
`At1g06650`	1-aminocyclopropane-1-carboxylate oxidase homolog 3.	No verified direct reference in this release
`At1g04350`	1-aminocyclopropane-1-carboxylate oxidase homolog 6.	No verified direct reference in this release
`At1g06640`	1-aminocyclopropane-1-carboxylate oxidase homolog 2.	No verified direct reference in this release
`At5g59530`	1-aminocyclopropane-1-carboxylate oxidase homolog 11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017763 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016629 12-oxophytodienoate reductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04350

ath:AT1G06620

ath:AT1G06640

ath:AT1G06650

ath:AT5G59530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.844

Rank 1 · LXL04_017763 · OH-1004

Nucleus0.319

Rank 2 · LXL04_017763 · OH-1004

Endoplasmic reticulum0.052

Rank 3 · LXL04_017763 · OH-1004

Mitochondrion0.041

Rank 4 · LXL04_017763 · OH-1004

Peroxisome0.039

Rank 5 · LXL04_017763 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N82-181 aa

PF03171.272OG-FeII_Oxy239-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017763	`PF14226.13`	DIOX_N	82	181	2.5e-16	61.1
LXL04_017763	`PF03171.27`	2OG-FeII_Oxy	239	331	1.5e-30	106.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MB3`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 1	56.267%	Swiss-Prot	strong database homology
`Q8H1S4`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 3	54.223%	Swiss-Prot	strong database homology
`P93824`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 6	53.846%	Swiss-Prot	strong database homology
`Q9C5K7`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 2	52.151%	Swiss-Prot	strong database homology
`Q9LTH8`	Arabidopsis thaliana	1-aminocyclopropane-1-carboxylate oxidase homolog 11	52.909%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card