LXL04_017740 | RubberDandelionOmics

Gene overview

LXL04_017740

Reference: OH-1004 Chr: Chr04 Coordinates: 608709-611288 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1875 bp · LXL04_017740|LXL04_017740|OH1004|cDNA

ATGGAGGAGCGCAAAAGTTCCACATATCTTCGTACCCAGGGCATGAATTTGGGGTCGAGGAGATTGCAACCCATCAATAACGAAGTTTATTTGAAAGAATATCTACATTCCGGAAGAAGAAGCGAATTTCCATTATTGATTATTAGAACTACAAAAGCTTCCCCGACACCAGAAAGATCATTTGTTAGAATTTATACAATTTCTCCAATGAAGGCACCCCCAGAAACATGTTTACCACcggccaccaccgccaccacttC...

CDS

Download CDS FASTA

1875 bp · LXL04_017740|LXL04_017740|OH1004|CDS

ATGGAGGAGCGCAAAAGTTCCACATATCTTCGTACCCAGGGCATGAATTTGGGGTCGAGGAGATTGCAACCCATCAATAACGAAGTTTATTTGAAAGAATATCTACATTCCGGAAGAAGAAGCGAATTTCCATTATTGATTATTAGAACTACAAAAGCTTCCCCGACACCAGAAAGATCATTTGTTAGAATTTATACAATTTCTCCAATGAAGGCACCCCCAGAAACATGTTTACCACCGGCCACCACCGCCACCACTTC...

Protein

Download Protein FASTA

624 aa · LXL04_017740|LXL04_017740|OH1004|PROTEIN

MEERKSSTYLRTQGMNLGSRRLQPINNEVYLKEYLHSGRRSEFPLLIIRTTKASPTPERSFVRIYTISPMKAPPETCLPPATTATTSRKKMSKQVTGKRDDTPLHTASRAGNINAVMEILGDCYCEEELISLLSKQNHAGETPLYVAAEYSYVDLVRLLIDQCDITTASIKANNGFDALHIAAKHGDLDTLKVLMEAHPELSMTVDISNTTALHTAAMQGNIEVMNYLLEIESSLVSIARSNGKTALHSASRNGHVRAVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017740`
TK1151 ID	TkA08G053410
OH-1004 ID	LXL04_017740
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 57.944 / OH-1004 19.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017740

Location Chr04:608709-611288 (-)

Description Similar to At5g02620: Ankyrin repeat-containing protein At5g02620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02620`	Ankyrin repeat-containing protein At5g02620.	No verified direct reference in this release
`At3g12360`	Involved in salt stress tolerance.	ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03614.x
`At2g01680`	Ankyrin repeat-containing protein At2g01680.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0837000`	Involved in salt stress tolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017740 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0051017 actin filament bundle assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT2G01680

ath:AT3G12360

ath:AT5G02620

dosa:Os01g0837000

mmu:227357

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.831

Rank 1 · LXL04_017740 · OH-1004

Cytoplasm0.094

Rank 2 · LXL04_017740 · OH-1004

Nucleus0.074

Rank 3 · LXL04_017740 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_017740 · OH-1004

Lysosome / Vacuole0.029

Rank 5 · LXL04_017740 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_298-167 aa

PF12796.14Ank_2172-231 aa

PF13857.13Ank_5173-216 aa

PF13637.13Ank_4179-229 aa

PF12796.14Ank_2241-301 aa

PF00023.37Ank242-266 aa

PF24521.3Ank_KRIT1244-354 aa

PF13637.13Ank_4247-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017740	`PF12796.14`	Ank_2	98	167	1.4e-44	151.3
LXL04_017740	`PF12796.14`	Ank_2	172	231	1.4e-44	151.3
LXL04_017740	`PF13857.13`	Ank_5	173	216	3.7e-31	107.6
LXL04_017740	`PF13637.13`	Ank_4	179	229	1e-36	124.9
LXL04_017740	`PF12796.14`	Ank_2	241	301	1.4e-44	151.3
LXL04_017740	`PF00023.37`	Ank	242	266	9.2e-42	139.4
LXL04_017740	`PF24521.3`	Ank_KRIT1	244	354	2.6e-11	44.2
LXL04_017740	`PF13637.13`	Ank_4	247	294	1e-36	124.9
LXL04_017740	`PF13857.13`	Ank_5	272	318	3.7e-31	107.6
LXL04_017740	`PF00023.37`	Ank	277	305	9.2e-42	139.4
LXL04_017740	`PF13637.13`	Ank_4	281	331	1e-36	124.9
LXL04_017740	`PF13857.13`	Ank_5	296	352	3.7e-31	107.6
LXL04_017740	`PF12796.14`	Ank_2	305	365	1.4e-44	151.3
LXL04_017740	`PF00023.37`	Ank	311	337	9.2e-42	139.4
LXL04_017740	`PF13962.12`	PGG	423	538	6.6e-28	97.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWW5`	Arabidopsis thaliana	Ankyrin repeat-containing protein At5g02620	60.887%	Swiss-Prot	strong database homology
`Q9C7A2`	Arabidopsis thaliana	Ankyrin repeat-containing protein ITN1	43.403%	Swiss-Prot	moderate database homology
`Q9ZU96`	Arabidopsis thaliana	Ankyrin repeat-containing protein At2g01680	43.888%	Swiss-Prot	moderate database homology
`A2CIR5`	Oryza sativa subsp. japonica	Ankyrin repeat-containing protein NPR4	42.473%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card