LXL04_017702 | RubberDandelionOmics

Gene overview

LXL04_017702

Reference: OH-1004 Chr: Chr03 Coordinates: 158054157-158056701 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · LXL04_017702|LXL04_017702|OH1004|cDNA

ATGTCCACGAGCTTGAGCTTATCGATGGCTTCTTCCACAATCGCTTGTTCTTCACCCGCTTCTTCTTCATCGCCGTGGTTCCGGCGAAATGCGGTTAAGACGCACTGCTCACTAATTGCTAAAAACAGTATCAAAGCTCCGTTGCCTCCGCTAAACCCTAAAGATCCATTTCTTTCCAAGCTCGCATCAGTGGCCGCTAGTTCACCGGAAAAGCTCCTTAATCGACCGGTTAACTCCGACACGCCTCCGTACTTGGACCT...

CDS

Download CDS FASTA

987 bp · LXL04_017702|LXL04_017702|OH1004|CDS

ATGTCCACGAGCTTGAGCTTATCGATGGCTTCTTCCACAATCGCTTGTTCTTCACCCGCTTCTTCTTCATCGCCGTGGTTCCGGCGAAATGCGGTTAAGACGCACTGCTCACTAATTGCTAAAAACAGTATCAAAGCTCCGTTGCCTCCGCTAAACCCTAAAGATCCATTTCTTTCCAAGCTCGCATCAGTGGCCGCTAGTTCACCGGAAAAGCTCCTTAATCGACCGGTTAACTCCGACACGCCTCCGTACTTGGACCT...

Protein

Download Protein FASTA

328 aa · LXL04_017702|LXL04_017702|OH1004|PROTEIN

MSTSLSLSMASSTIACSSPASSSSPWFRRNAVKTHCSLIAKNSIKAPLPPLNPKDPFLSKLASVAASSPEKLLNRPVNSDTPPYLDLFESPTLMATPATVERSVSYNEHRPRRPPPDLPSLLLHGRIVYLGMPLVPAVTELIIAELMYLQWMDPKEPIYMYINSTGTTRDDGESVGMETEGFAIYDAMMQLKNEIHTVGVGAAIGHACLLLAAGSKGKRFMMPHAKAMIQQPRVPSSGLMTGSDVLIRAKEVIVNKDTLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017702`
TK1151 ID	TkA02G004610
OH-1004 ID	LXL04_017702
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017702

Location Chr03:158054157-158056701 (-)

Description Similar to CLPR3: ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09130`	ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic.	No verified direct reference in this release
`At4g17040`	Involved in plastid protein homeostasis.	No verified direct reference in this release
`At1g49970`	Required for chloroplast development and differentiation.	An Arabidopsis thaliana virescent mutant reveals a role for ClpR1 in plastid development.2007 · DOI: 10.1007/s11103-006-9074-2 Mutations in SUPPRESSOR OF VARIEGATION1, a factor required for normal chloroplast translation, suppress var2-mediated leaf variegation in Arabidopsis.2008 · DOI: 10.1105/tpc.107.054965

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017702 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006396 RNA processing Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009368 endopeptidase Clp complex Cellular Component

KEGG gene cross-reference

ath:AT1G09130

ath:AT1G49970

ath:AT4G17040

syf:Synpcc7942_2538

syn:slr0164

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.910

Rank 1 · LXL04_017702 · OH-1004

Mitochondrion0.070

Rank 2 · LXL04_017702 · OH-1004

Nucleus0.038

Rank 3 · LXL04_017702 · OH-1004

Cytoplasm0.015

Rank 4 · LXL04_017702 · OH-1004

Cell membrane0.015

Rank 5 · LXL04_017702 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00574.29CLP_protease120-299 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017702	`PF00574.29`	CLP_protease	120	299	7e-43	147.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L770`	Arabidopsis thaliana	ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic	74.468%	Swiss-Prot	strong database homology
`Q8LB10`	Arabidopsis thaliana	ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic	50.515%	Swiss-Prot	moderate database homology
`Q9XJ35`	Arabidopsis thaliana	ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic	46.073%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card